DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and DCLK2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001035351.4 Gene:DCLK2 / 166614 HGNCID:19002 Length:783 Species:Homo sapiens


Alignment Length:243 Identity:45/243 - (18%)
Similarity:89/243 - (36%) Gaps:68/243 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKNPNCDLYTLEANMASQ--ALRELTDGEDK-DPITKLRLLCLSRGATGILGLGRAFRAMDDDGS 74
            :|:||..:...|...|::  .:.||..|.|. |.||.........|:..:..|..|.|.:.    
Human   464 VKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLH---- 524

  Fly    75 KALNEEEFITGIRDTGLDVSEEEIK--QMFATFDEDGSGSINMTEFLLK--LRPPM--------- 126
                           ||.:...:||  .:......||:.|:.:.:|.|.  :..|:         
Human   525 ---------------GLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTY 574

  Fly   127 --PQSRLNIIDQAFN-KMDRDEDGVIT------IQDLKNVYSVKEH--------------PKYQS 168
              |:.   |.:..:. |:|....||||      ....::..:::|.              |.:.:
Human   575 VAPEI---IAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDN 636

  Fly   169 GEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNY-YATISASIDNDM 215
            ...|..|:::..|      :.|::.:.|..:.::: :.:..||.:|:|
Human   637 ITDSAKELISQML------QVNVEARCTAGQILSHPWVSDDASQENNM 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/58 (17%)
EFh 64..119 CDD:238008 9/56 (16%)
EFh 97..154 CDD:238008 16/78 (21%)
EF-hand_7 98..158 CDD:290234 16/81 (20%)
EF-hand_7 134..204 CDD:290234 13/91 (14%)
DCLK2NP_001035351.4 DCX 67..157 CDD:214711
DCX 192..280 CDD:214711
STKc_DCKL2 409..667 CDD:271086 41/230 (18%)
S_TKc 411..668 CDD:214567 41/231 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.