DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CAPSL

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006714507.1 Gene:CAPSL / 133690 HGNCID:28375 Length:225 Species:Homo sapiens


Alignment Length:202 Identity:103/202 - (50%)
Similarity:147/202 - (72%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRD 88
            :..||.||.::||..  .|||.:|||.||:||:.||.||||.||.||||.::.|:.:||:.|:.|
Human    25 DREMAIQAKKKLTTA--TDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLND 87

  Fly    89 TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD 153
            ..:.:.:||::::|..||:||:|:|:..||||.|||||.::|..:|.|||.|:|:..||||||:|
Human    88 YAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIED 152

  Fly   154 LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFD 218
            |:.||:.|.|||||:||.||:::...||.||:... :.||.:|.|||:||||.:|||||.|::|.
Human   153 LREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPY-DKDGLVTPEEFMNYYAGVSASIDTDVYFI 216

  Fly   219 LMMRRAY 225
            :|||.|:
Human   217 IMMRTAW 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 24/56 (43%)
EFh 64..119 CDD:238008 22/54 (41%)
EFh 97..154 CDD:238008 30/56 (54%)
EF-hand_7 98..158 CDD:290234 31/59 (53%)
EF-hand_7 134..204 CDD:290234 37/69 (54%)
CAPSLXP_006714507.1 EF-hand_7 61..118 CDD:290234 24/56 (43%)
EFh 63..118 CDD:238008 22/54 (41%)
EF-hand_7 100..157 CDD:290234 31/56 (55%)
EFh 101..155 CDD:238008 31/53 (58%)
EF-hand_7 133..202 CDD:290234 37/69 (54%)
EFh 133..199 CDD:298682 35/66 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144776
Domainoid 1 1.000 82 1.000 Domainoid score I8408
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16959
Inparanoid 1 1.050 211 1.000 Inparanoid score I3661
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - mtm8486
orthoMCL 1 0.900 - - OOG6_103375
Panther 1 1.100 - - LDO PTHR34524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5421
SonicParanoid 1 1.000 - - X4009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.