DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AgaP_AGAP009260

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_320052.4 Gene:AgaP_AGAP009260 / 1280223 VectorBaseID:AGAP009260 Length:185 Species:Anopheles gambiae


Alignment Length:170 Identity:53/170 - (31%)
Similarity:82/170 - (48%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEI 98
            ||:|.:.:|                   :..||...|.:|:..::.:|....||..|.:..:|||
Mosquito    37 ELSDEQRQD-------------------IKEAFDLFDSEGTGMIDTKELKVAIRALGFEPKKEEI 82

  Fly    99 KQMFATFDEDGSGSINMTEFLLKLRPPMPQ--SRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVK 161
            |:|.|..|:||||.|:..:||..:...|.:  |:..|: :||...|.||.|.|:.::||.|  .|
Mosquito    83 KKMIAEIDKDGSGKISFDDFLQLMTVKMAEKDSKEEIL-KAFRLFDDDETGTISFKNLKRV--AK 144

  Fly   162 EHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201
            |     .||...||.|.:.:.  |..|.. ||::.:|||:
Mosquito   145 E-----LGENLTDEELQEMID--EADRDG-DGEVNQEEFL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 20/54 (37%)
EFh 97..154 CDD:238008 23/58 (40%)
EF-hand_7 98..158 CDD:290234 24/61 (39%)
EF-hand_7 134..204 CDD:290234 24/68 (35%)
AgaP_AGAP009260XP_320052.4 PTZ00183 29..185 CDD:185503 53/170 (31%)
EFh 45..107 CDD:238008 23/80 (29%)
EFh 118..180 CDD:238008 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.