DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and AgaP_AGAP005471

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	XP_315475.4	Gene:	AgaP_AGAP005471 / 1276165	VectorBaseID:	AGAP005471	Length:	5295	Species:	Anopheles gambiae

Alignment Length:	127	Identity:	32/127 - (25%)
Similarity:	52/127 - (40%)	Gaps:	37/127 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 FDEDGSGSINMTEFLLKLRPPMPQ-SRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQS 168
            |:||....|.:.:.:  :.|..|. |.|::          :|...||..      |.::..:|||
Mosquito  2634 FEEDSGSPIEVMQKI--IYPNKPHASALHV----------EEIDTITFT------SPEQKRQYQS 2680

  Fly   169 GEKSEDEILTDFLHNFE------GGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRA 224
            .:.:.|.....|:..||      ||:    ||::|...:|     |||.|.   ..|:.|:|
Mosquito  2681 QQSASDAATRTFIEEFESDNDSAGGK----GKLSRGVSIN-----SASEDE---LQLLSRQA 2730

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	4/13 (31%)
		EFh	64..119	CDD:238008	4/13 (31%)
		EFh	97..154	CDD:238008	11/49 (22%)
		EF-hand_7	98..158	CDD:290234	11/53 (21%)
		EF-hand_7	134..204	CDD:290234	17/75 (23%)
AgaP_AGAP005471	XP_315475.4	RhoGEF	140..284	CDD:238091
		PH-like	313..409	CDD:302622
		BASP1	1001..1214	CDD:283191
		DUF4775	1100..1451	CDD:292620
		I-set	1724..1814	CDD:254352
		Ig	1752..1811	CDD:143165
		I-set	1831..1924	CDD:254352
		Ig	1848..1921	CDD:143165
		Ig	1942..2000	CDD:143165
		I-set	2017..2107	CDD:254352
		Ig	2036..2107	CDD:299845
		Ig	2110..2194	CDD:299845
		I-set	2110..2192	CDD:254352
		IG	2210..2294	CDD:214652
		Ig	2221..2287	CDD:143165
		I-set	2303..2389	CDD:254352
		Ig	2316..2385	CDD:143165
		I-set	2393..2485	CDD:254352
		Ig	2409..2485	CDD:299845
		Ig	2923..2987	CDD:299845
		I-set	2996..3094	CDD:254352
		Ig	3013..3089	CDD:143165
		I-set	3104..3188	CDD:254352
		Ig	3120..3188	CDD:299845
		I-set	3193..3293	CDD:254352
		Ig	3216..3290	CDD:143165
		I-set	3298..3389	CDD:254352
		Ig	3316..3383	CDD:143165
		I-set	3396..3484	CDD:254352
		IGc2	3410..3476	CDD:197706
		I-set	3493..3582	CDD:254352
		Ig	<3518..3578	CDD:299845
		I-set	3595..3680	CDD:254352
		IGc2	3608..3674	CDD:197706
		I-set	3691..3780	CDD:254352
		Ig	<3716..3780	CDD:299845
		I-set	3793..3882	CDD:254352
		Ig	3810..3880	CDD:143165
		FN3	3906..3999	CDD:238020
		Ig	4065..4129	CDD:299845
		I-set	4141..4231	CDD:254352
		Ig	4159..4231	CDD:299845
		PKc_like	4256..4514	CDD:304357
		S_TKc	4260..4514	CDD:214567
		I-set	4730..4820	CDD:254352
		Ig	4749..4814	CDD:143165
		FN3	4824..4917	CDD:238020
		PKc_like	4970..5229	CDD:304357
		S_TKc	4974..5229	CDD:214567
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900