DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AgaP_AGAP005306

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_309099.4 Gene:AgaP_AGAP005306 / 1270367 VectorBaseID:AGAP005306 Length:408 Species:Anopheles gambiae


Alignment Length:185 Identity:37/185 - (20%)
Similarity:70/185 - (37%) Gaps:29/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPNC-DLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGA--------TGILGLGRAFRAM 69
            |.||. |.|.::..:.:.|..|:...|.::...:..:..:.:.|        ...:.:.:.|.|.
Mosquito    23 KLPNIDDKYVIKELLGTGAFSEVRLCEHRETAQQYAVKIIDKKALKGKEDSLENEIRVLKRFSAR 87

  Fly    70 DDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT--------EFLLKLRPPM 126
            ..|||........|.|.|     .:...|.|:..||::.....:.|.        :.:::.....
Mosquito    88 RSDGSGVQTAAPPIGGPR-----FAHPNIVQLLETFEDKSKVYLIMELVTGGELFDRIVEKGSYT 147

  Fly   127 PQSRLNIIDQAFNKMD-RDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDF 180
            .:...|:|.|....:| ..|.||:. :|||     .|:..|.|..:....:::||
Mosquito   148 ERDASNLIRQVLEAVDYMHEQGVVH-RDLK-----PENLLYYSAAEDSKIMISDF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/64 (20%)
EFh 64..119 CDD:238008 13/62 (21%)
EFh 97..154 CDD:238008 12/65 (18%)
EF-hand_7 98..158 CDD:290234 15/68 (22%)
EF-hand_7 134..204 CDD:290234 14/48 (29%)
AgaP_AGAP005306XP_309099.4 STKc_CaMKI 27..307 CDD:270985 34/181 (19%)
S_TKc 31..308 CDD:214567 33/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.