DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AgaP_AGAP007666

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_308204.3 Gene:AgaP_AGAP007666 / 1269561 VectorBaseID:AGAP007666 Length:215 Species:Anopheles gambiae


Alignment Length:202 Identity:125/202 - (61%)
Similarity:158/202 - (78%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRD 88
            |:.|.:::.|.|:.|...|.|.|||.:||:|||:|||||||.||.|||||:|.||.||||.|:.|
Mosquito    13 ESEMINRSRRALSSGALTDSIEKLRHMCLARGASGILGLGRCFRRMDDDGNKQLNLEEFIKGLHD 77

  Fly    89 TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD 153
            ||||:|.||..:||..||.||||||||||||:.:||.|.:||::|:.|||.|:|:..||.|||:|
Mosquito    78 TGLDISAEEATEMFNKFDTDGSGSINMTEFLVAIRPNMSESRVSIVKQAFAKLDKTGDGTITIED 142

  Fly   154 LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFD 218
            ||||||||.||.|.|||::||.||..:|.||| ..||:||.:|:|||:||||.:|||||:|.:||
Mosquito   143 LKNVYSVKNHPLYISGEETEDVILRKYLANFE-ENGNVDGSVTKEEFLNYYAGLSASIDSDAYFD 206

  Fly   219 LMMRRAY 225
            ||||:|:
Mosquito   207 LMMRQAF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 40/56 (71%)
EFh 64..119 CDD:238008 38/54 (70%)
EFh 97..154 CDD:238008 33/56 (59%)
EF-hand_7 98..158 CDD:290234 36/59 (61%)
EF-hand_7 134..204 CDD:290234 42/69 (61%)
AgaP_AGAP007666XP_308204.3 EF-hand_7 51..108 CDD:290234 40/56 (71%)
EFh 55..112 CDD:238008 39/56 (70%)
EFh 86..143 CDD:238008 33/56 (59%)
EF-hand_7 89..147 CDD:290234 36/57 (63%)
EF-hand_7 123..192 CDD:290234 42/69 (61%)
EFh 123..189 CDD:298682 40/66 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I14075
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16959
Inparanoid 1 1.050 252 1.000 Inparanoid score I5583
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - otm49717
Panther 1 1.100 - - LDO PTHR34524
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4009
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.