DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AgaP_AGAP010632

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_307828.4 Gene:AgaP_AGAP010632 / 1269214 VectorBaseID:AGAP010632 Length:372 Species:Anopheles gambiae


Alignment Length:143 Identity:28/143 - (19%)
Similarity:56/143 - (39%) Gaps:40/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEE--EFITGIRDTGL--------- 91
            |...||..||::|               |...:....:.:|.|  .|.|.:...|:         
Mosquito   156 GRKYDPDNKLQVL---------------FGTPEFVAPEVVNFEAISFATDMWSVGVIAYVLVSGL 205

  Fly    92 --DVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD- 153
              ...|::|:.|       |:.:|...:||.:....:.:..::.|::...|..::.   :|.:| 
Mosquito   206 SPFAGEDDIQTM-------GNITIGRYDFLDEAFDNVSEEAIDFINRCLVKEQKER---LTAEDA 260

  Fly   154 LKNVYSVKEHPKY 166
            ||:.: :|..|:|
Mosquito   261 LKHKW-IKRKPQY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/69 (16%)
EFh 64..119 CDD:238008 11/67 (16%)
EFh 97..154 CDD:238008 10/57 (18%)
EF-hand_7 98..158 CDD:290234 12/60 (20%)
EF-hand_7 134..204 CDD:290234 9/34 (26%)
AgaP_AGAP010632XP_307828.4 S_TKc 34..266 CDD:214567 25/135 (19%)
PKc_like 40..266 CDD:304357 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.