Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006525606.1 | Gene: | Camk4 / 12326 | MGIID: | 88258 | Length: | 497 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 39/198 - (19%) |
---|---|---|---|
Similarity: | 71/198 - (35%) | Gaps: | 59/198 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 NCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEE 81
Fly 82 FITG--IRDTGLDVSEEEIKQMFA------------TFDEDGSGSINMTEFLLKLR----PPMPQ 128
Fly 129 SRLNIIDQAFNKM---DRDEDGV---ITIQDLKNVYSVKEHPKYQSGEKS-----------EDEI 176
Fly 177 LTD 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 10/70 (14%) |
EFh | 64..119 | CDD:238008 | 10/68 (15%) | ||
EFh | 97..154 | CDD:238008 | 15/78 (19%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 15/81 (19%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 16/63 (25%) | ||
Camk4 | XP_006525606.1 | STKc_CaMKIV | 66..359 | CDD:270987 | 16/100 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |