DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Camk4

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006525606.1 Gene:Camk4 / 12326 MGIID:88258 Length:497 Species:Mus musculus


Alignment Length:198 Identity:39/198 - (19%)
Similarity:71/198 - (35%) Gaps:59/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEE 81
            ||:.|.:.......:|..      ||.:.||.:|...:..|       .|:|:         :..
Mouse   280 NCEYYFISPWWDEVSLNA------KDLVKKLIVLDPKKRLT-------TFQAL---------QHP 322

  Fly    82 FITG--IRDTGLDVSEEEIKQMFA------------TFDEDGSGSINMTEFLLKLR----PPMPQ 128
            ::||  .....:|.:::::::..|            .....||.|.:.|......:    ||..|
Mouse   323 WVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTSIQENHKASSDPPSTQ 387

  Fly   129 SRLNIIDQAFNKM---DRDEDGV---ITIQDLKNVYSVKEHPKYQSGEKS-----------EDEI 176
            ...:..|....||   |::||.|   .:..:::.:.|  |..:..:|.|.           |||:
Mouse   388 DAKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQS--EEVEKDAGVKEEETSSMVPQDPEDEL 450

  Fly   177 LTD 179
            .||
Mouse   451 ETD 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/70 (14%)
EFh 64..119 CDD:238008 10/68 (15%)
EFh 97..154 CDD:238008 15/78 (19%)
EF-hand_7 98..158 CDD:290234 15/81 (19%)
EF-hand_7 134..204 CDD:290234 16/63 (25%)
Camk4XP_006525606.1 STKc_CaMKIV 66..359 CDD:270987 16/100 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.