DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CETN2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004335.1 Gene:CETN2 / 1069 HGNCID:1867 Length:172 Species:Homo sapiens


Alignment Length:187 Identity:56/187 - (29%)
Similarity:90/187 - (48%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALR-------ELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEE 81
            :|||||.:.|       |||: |.|..|.:                  ||...|.||:..::.:|
Human     7 KANMASSSQRKRMSPKPELTE-EQKQEIRE------------------AFDLFDADGTGTIDVKE 52

  Fly    82 FITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQ--SRLNIIDQAFNKMDRD 144
            ....:|..|.:..:||||:|.:..|::|:|.:|..:||..:...|.:  ::..|: :||...|.|
Human    53 LKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEIL-KAFKLFDDD 116

  Fly   145 EDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201
            |.|.|:.::||.|  .||     .||...||.|.:.:.  |..|.. ||:::.:||:
Human   117 ETGKISFKNLKRV--AKE-----LGENLTDEELQEMID--EADRDG-DGEVSEQEFL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/56 (30%)
EFh 64..119 CDD:238008 17/54 (31%)
EFh 97..154 CDD:238008 19/58 (33%)
EF-hand_7 98..158 CDD:290234 20/61 (33%)
EF-hand_7 134..204 CDD:290234 23/68 (34%)
CETN2NP_004335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 10/23 (43%)
Required for self-assembly 2..25 6/17 (35%)
PTZ00183 16..172 CDD:185503 51/178 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.