DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and SPEG

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011508781.1 Gene:SPEG / 10290 HGNCID:16901 Length:3277 Species:Homo sapiens


Alignment Length:173 Identity:36/173 - (20%)
Similarity:66/173 - (38%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT 116
            ||..:..:..|||:.|.: ..||:.|::.:|.            ||.::.....|...:      
Human   387 LSEASGRLSALGRSPRLV-RAGSRILDKLQFF------------EERRRSLERSDSPPA------ 432

  Fly   117 EFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGV------ITIQDLKNVYSVKEHPK-YQSGEKSED 174
                .|||.:|..:...::|     .:.|.|.      .:.::|:...||.|..: :|....|.|
Human   433 ----PLRPWVPLRKARSLEQ-----PKSERGAPWGTPGASQEELRAPGSVAERRRLFQQKAASLD 488

  Fly   175 E------ILTDFLHNFEGGRGNLDGKITREEFVNYYATISASI 211
            |      ..:|....|....|.:....:|||.|..:.::.|::
Human   489 ERTRQRSPASDLELRFAQELGRIRRSTSREELVRSHESLRATL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/56 (20%)
EFh 64..119 CDD:238008 9/54 (17%)
EFh 97..154 CDD:238008 9/62 (15%)
EF-hand_7 98..158 CDD:290234 9/65 (14%)
EF-hand_7 134..204 CDD:290234 18/82 (22%)
SPEGXP_011508781.1 I-set 43..125 CDD:254352
Ig 45..125 CDD:299845
I-set 732..821 CDD:254352
Ig 755..822 CDD:299845
SPEG_u2 822..878 CDD:293256
I-set 879..969 CDD:254352
IGc2 892..959 CDD:197706
I-set 983..1068 CDD:254352
Ig 995..1065 CDD:143165
I-set 1074..1163 CDD:254352
Ig 1091..1163 CDD:299845
I-set 1198..1287 CDD:254352
Ig 1215..1287 CDD:299845
I-set 1400..1490 CDD:254352
I-set 1495..1584 CDD:254352
Ig 1512..1581 CDD:143165
STKc_SPEG_rpt1 1608..1864 CDD:271010
S_TKc 1611..1864 CDD:214567
I-set 2594..2684 CDD:254352
Ig 2615..2684 CDD:299845
STKc_SPEG_rpt2 2972..3228 CDD:271013
S_TKc 2976..3228 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.