powered by:
Protein Alignment CG10126 and crem
DIOPT Version :9
Sequence 1: | NP_788664.2 |
Gene: | CG10126 / 41579 |
FlyBaseID: | FBgn0038088 |
Length: | 227 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002935208.1 |
Gene: | crem / 100492439 |
XenbaseID: | XB-GENE-986312 |
Length: | 102 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 14/67 - (20%) |
Similarity: | 28/67 - (41%) |
Gaps: | 8/67 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 GVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASI 211
||:......|:: :|:..:.|.:....|. .|.|.|..| :.:..::|:|.......|.:
Frog 23 GVVVSPSTNNLH----NPQIMAEEVTRKRELR-LLKNREAAR---ECRKKKKEYVKCLENRVAVL 79
Fly 212 DN 213
:|
Frog 80 EN 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.