DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and caps2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_004913010.2 Gene:caps2 / 100380015 XenbaseID:XB-GENE-958065 Length:632 Species:Xenopus tropicalis


Alignment Length:223 Identity:62/223 - (27%)
Similarity:111/223 - (49%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LREIRTKGWSLKNPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFR 67
            ||:|..:    |...|.|:.........|::::..       .||:    |||...:.|||:.||
 Frog   424 LRDISGE----KQLGCGLHWSNEGNVFWAMQDMMK-------EKLK----SRGVQTLTGLGKFFR 473

  Fly    68 AMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLN 132
            .:|::|...|.:.:|...::...||||||..:..:...||...|.::..:|...|...|.:.|..
 Frog   474 QVDENGDGILQKAKFKQALKVFHLDVSEEIFESFWKILDEKHEGKLDYGKFTRALIGEMNEYRKT 538

  Fly   133 IIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITR 197
            .:.:||.|:|.::.|:|.:.|::..|..::||:..||..||:|||:.||...:....| ..:::.
 Frog   539 FVQKAFMKLDPNKSGIIPMIDIRKFYCARKHPQVLSGHSSEEEILSSFLKTLQAACRN-PKEVSY 602

  Fly   198 EEFVNYYATISASIDNDMFFDLMMRRAY 225
            .||.::|..:|..|.:|..|..::|.::
 Frog   603 CEFEDFYEGLSIEILSDNDFINILRNSW 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/56 (30%)
EFh 64..119 CDD:238008 15/54 (28%)
EFh 97..154 CDD:238008 13/56 (23%)
EF-hand_7 98..158 CDD:290234 14/59 (24%)
EF-hand_7 134..204 CDD:290234 22/69 (32%)
caps2XP_004913010.2 EFh 470..528 CDD:415501 16/57 (28%)
EF-hand_7 501..565 CDD:404394 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.