DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and caps

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001090789.1 Gene:caps / 100037881 XenbaseID:XB-GENE-956400 Length:208 Species:Xenopus tropicalis


Alignment Length:203 Identity:99/203 - (48%)
Similarity:142/203 - (69%) Gaps:3/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIR 87
            ||..|.::|.|:..  :.:||:.||||.||:|||:||.|||||||.|||:.|..|:.|||..|::
 Frog     7 LEREMMAKAQRQYP--QCQDPVEKLRLQCLARGASGIKGLGRAFRIMDDNRSSTLDLEEFSKGLQ 69

  Fly    88 DTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQ 152
            :.|:.:...|:..:|..||.:|:|:||..|||:.:||||..:|..:|..||.||||..||||||:
 Frog    70 NFGISLQPSEVLDIFHQFDTNGNGTINFDEFLISIRPPMSNARRQVILDAFKKMDRTGDGVITIE 134

  Fly   153 DLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFF 217
            |||.||:.|.|.||::||.:|.::..:||.||: ...|.||::|.|||:|||:.:|||||:|.:|
 Frog   135 DLKGVYNPKFHQKYRNGEWNERQVFQNFLDNFD-SPNNKDGQVTEEEFLNYYSGVSASIDSDAYF 198

  Fly   218 DLMMRRAY 225
            .:||:..:
 Frog   199 VVMMKNEW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 25/56 (45%)
EFh 64..119 CDD:238008 23/54 (43%)
EFh 97..154 CDD:238008 29/56 (52%)
EF-hand_7 98..158 CDD:290234 31/59 (53%)
EF-hand_7 134..204 CDD:290234 37/69 (54%)
capsNP_001090789.1 PTZ00183 41..183 CDD:185503 70/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8503
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3536
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - mtm9381
Panther 1 1.100 - - O PTHR34524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.