DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Va and F11R

DIOPT Version :10

Sequence 1:NP_650233.3 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:206 Identity:48/206 - (23%)
Similarity:80/206 - (38%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LMFLFIALLIDYPIAYALFVTDISVPEI-VDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFR-- 67
            |:.|||..::...:|........|.||: :...:.|.|||:|.  |.:...|:|..|..:..|  
Human    11 LLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYS--GFSSPRVEWKFDQGDTTRLV 73

  Fly    68 -YSPLTSPIY---MTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVS--GDAPHFKL 126
             |:...:..|   :||...|:..   |.|..|             .||.|.|.||  |...:.::
Human    74 CYNNKITASYEDRVTFLPTGITF---KSVTRE-------------DTGTYTCMVSEEGGNSYGEV 122

  Fly   127 ADKADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTT 191
            ..|    .:..:|.:.|.: :..|...:......||.....|.|:..||:.:|   ::....|.:
Human   123 KVK----LIVLVPPSKPTV-NIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDG---IVMPTNPKS 179

  Fly   192 DTSLAAHDYVL 202
            ..:.:...|||
Human   180 TRAFSNSSYVL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VaNP_650233.3 None
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 29/120 (24%)
FR1 30..52 CDD:409538 7/21 (33%)
Ig strand A 30..33 CDD:409538 0/2 (0%)
Ig strand A' 37..41 CDD:409538 1/3 (33%)
Ig strand B 44..53 CDD:409538 4/8 (50%)
CDR1 53..58 CDD:409538 1/6 (17%)
Ig strand C 58..66 CDD:409538 2/7 (29%)
FR2 59..66 CDD:409538 2/6 (33%)
CDR2 69..83 CDD:409538 2/13 (15%)
Ig strand C' 69..74 CDD:409538 1/4 (25%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 10/43 (23%)
Ig strand D 86..90 CDD:409538 1/3 (33%)
Ig strand E 92..96 CDD:409538 1/3 (33%)
Ig strand F 105..113 CDD:409538 4/7 (57%)
CDR3 113..119 CDD:409538 1/5 (20%)
Ig strand G 119..128 CDD:409538 1/12 (8%)
FR4 120..129 CDD:409538 1/12 (8%)
IgI_2_JAM1 135..231 CDD:409542 13/60 (22%)
Ig strand A 135..139 CDD:409542 1/4 (25%)
Ig strand A' 141..144 CDD:409542 1/2 (50%)
Ig strand B 147..155 CDD:409542 2/7 (29%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 1/4 (25%)
Ig strand D 187..191 CDD:409542 3/4 (75%)
Ig strand E 195..199 CDD:409542
Ig strand F 208..214 CDD:409542
Ig strand G 221..231 CDD:409542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.