| Sequence 1: | NP_650233.3 | Gene: | beat-Va / 41578 | FlyBaseID: | FBgn0038087 | Length: | 300 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
| Alignment Length: | 206 | Identity: | 48/206 - (23%) |
|---|---|---|---|
| Similarity: | 80/206 - (38%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LMFLFIALLIDYPIAYALFVTDISVPEI-VDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFR-- 67
Fly 68 -YSPLTSPIY---MTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVS--GDAPHFKL 126
Fly 127 ADKADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTT 191
Fly 192 DTSLAAHDYVL 202 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-Va | NP_650233.3 | None | |||
| F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 29/120 (24%) |
| FR1 | 30..52 | CDD:409538 | 7/21 (33%) | ||
| Ig strand A | 30..33 | CDD:409538 | 0/2 (0%) | ||
| Ig strand A' | 37..41 | CDD:409538 | 1/3 (33%) | ||
| Ig strand B | 44..53 | CDD:409538 | 4/8 (50%) | ||
| CDR1 | 53..58 | CDD:409538 | 1/6 (17%) | ||
| Ig strand C | 58..66 | CDD:409538 | 2/7 (29%) | ||
| FR2 | 59..66 | CDD:409538 | 2/6 (33%) | ||
| CDR2 | 69..83 | CDD:409538 | 2/13 (15%) | ||
| Ig strand C' | 69..74 | CDD:409538 | 1/4 (25%) | ||
| Ig strand C' | 77..79 | CDD:409538 | 0/1 (0%) | ||
| FR3 | 84..112 | CDD:409538 | 10/43 (23%) | ||
| Ig strand D | 86..90 | CDD:409538 | 1/3 (33%) | ||
| Ig strand E | 92..96 | CDD:409538 | 1/3 (33%) | ||
| Ig strand F | 105..113 | CDD:409538 | 4/7 (57%) | ||
| CDR3 | 113..119 | CDD:409538 | 1/5 (20%) | ||
| Ig strand G | 119..128 | CDD:409538 | 1/12 (8%) | ||
| FR4 | 120..129 | CDD:409538 | 1/12 (8%) | ||
| IgI_2_JAM1 | 135..231 | CDD:409542 | 13/60 (22%) | ||
| Ig strand A | 135..139 | CDD:409542 | 1/4 (25%) | ||
| Ig strand A' | 141..144 | CDD:409542 | 1/2 (50%) | ||
| Ig strand B | 147..155 | CDD:409542 | 2/7 (29%) | ||
| Ig strand C | 163..168 | CDD:409542 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409542 | 1/4 (25%) | ||
| Ig strand D | 187..191 | CDD:409542 | 3/4 (75%) | ||
| Ig strand E | 195..199 | CDD:409542 | |||
| Ig strand F | 208..214 | CDD:409542 | |||
| Ig strand G | 221..231 | CDD:409542 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||