DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31345 and CAPS2

DIOPT Version :10

Sequence 1:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_047285680.1 Gene:CAPS2 / 84698 HGNCID:16471 Length:614 Species:Homo sapiens


Alignment Length:176 Identity:48/176 - (27%)
Similarity:92/176 - (52%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDTDGSG 97
            |:.:...||...:.||.:.|:.:|.:|:..|...:||:.:....|::::.:.:..:...:.:|:|
Human   435 LKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNG 499

  Fly    98 NINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSVRDHPKYLSGEMTENQI 162
            .::..||...:...||..|.|.:.|||.|:|.|..|.:.:.:::..|..:.|.:.:||..||.:|
Human   500 KVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISGHSTEEEI 564

  Fly   163 FTQFLKNFEVGAPNPDGIVTREEFINYYATISASIDNDAYFDLMMR 208
            .:.||:..:|.....|. |:..||.:||..:|..|.:|..|..::|
Human   565 KSSFLETLKVACSKSDE-VSYGEFEDYYEGLSIGIVDDEDFVNILR 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31345NP_731744.1 FRQ1 48..186 CDD:444056 35/137 (26%)
CAPS2XP_047285680.1 PTZ00183 454..609 CDD:185503 42/155 (27%)
EFh 454..510 CDD:238008 11/55 (20%)

Return to query results.
Submit another query.