DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31345 and CG10126

DIOPT Version :9

Sequence 1:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:205 Identity:136/205 - (66%)
Similarity:167/205 - (81%) Gaps:0/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YSKEAELKNLAKRELANGLDKDPIYKLRLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKG 71
            |:.||.:.:.|.|||.:|.|||||.||||.|.||||||||||.|:||.|||||||:|:.|||..|
  Fly    21 YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITG 85

  Fly    72 VTDIGLDLTDSEIDEMFSRFDTDGSGNINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQIT 136
            :.|.|||:::.||.:||:.||.||||:|||||||:||||||..||::||::||:|||.:.||.||
  Fly    86 IRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVIT 150

  Fly   137 VTDLKNVYSVRDHPKYLSGEMTENQIFTQFLKNFEVGAPNPDGIVTREEFINYYATISASIDNDA 201
            :.||||||||::||||.|||.:|::|.|.||.|||.|..|.||.:|||||:|||||||||||||.
  Fly   151 IQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDM 215

  Fly   202 YFDLMMRQAY 211
            :||||||:||
  Fly   216 FFDLMMRRAY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31345NP_731744.1 EF-hand_7 48..105 CDD:290234 35/56 (63%)
EFh 48..105 CDD:238008 35/56 (63%)
EFh 83..136 CDD:238008 34/52 (65%)
EF-hand_7 84..144 CDD:290234 39/59 (66%)
EF-hand_7 120..190 CDD:290234 43/69 (62%)
EFh 120..187 CDD:298682 41/66 (62%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 35/56 (63%)
EFh 64..119 CDD:238008 34/54 (63%)
EFh 97..154 CDD:238008 36/56 (64%)
EF-hand_7 98..158 CDD:290234 39/59 (66%)
EF-hand_7 134..204 CDD:290234 43/69 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445128
Domainoid 1 1.000 80 1.000 Domainoid score I8536
eggNOG 1 0.900 - - E1_KOG0032
Homologene 1 1.000 - - H16959
Inparanoid 1 1.050 215 1.000 Inparanoid score I3592
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - mtm6408
orthoMCL 1 0.900 - - OOG6_103375
Panther 1 1.100 - - P PTHR34524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5421
SonicParanoid 1 1.000 - - X4009
1413.840

Return to query results.
Submit another query.