DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT89B1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_177529.2 Gene:UGT89B1 / 843725 AraportID:AT1G73880 Length:473 Species:Arabidopsis thaliana


Alignment Length:296 Identity:61/296 - (20%)
Similarity:103/296 - (34%) Gaps:57/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 MNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQR-------- 204
            ::||.||:.:.:..|..   ...|:..:...|.|.|.:......|..:.::.:.|.:        
plant   125 VSDFFLGWTKNLGIPRF---DFSPSAAITCCILNTLWIEMPTKINEDDDNEILHFPKIPNCPKYR 186

  Fly   205 --RLSSYMQSLGFG----VFSHLSERRN-RNWYKEVYGNDPKMPEYSEMLKNTSLVFFSSHAASE 262
              ::||..:|...|    .|...|.|.| .:|...|.........|.|.||..   .......:.
plant   187 FDQISSLYRSYVHGDPAWEFIRDSFRDNVASWGLVVNSFTAMEGVYLEHLKRE---MGHDRVWAV 248

  Fly   263 GPIRP------NVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDG-AILLSLGSNVQGKHLNPDT 320
            |||.|      ..|:::.:             .::..:|....|. .:.:..||.|.   |..:.
plant   249 GPIIPLSGDNRGGPTSVSV-------------DHVMSWLDAREDNHVVYVCFGSQVV---LTKEQ 297

  Fly   321 VAKMFNVLSKLKERVIWKWEDQENTPGKSANIL-------------YSKWLPQDDILAHPNIKLF 372
            ...:.:.|.|.....||..::.........|||             ...|.||..:|.|..:..|
plant   298 TLALASGLEKSGVHFIWAVKEPVEKDSTRGNILDGFDDRVAGRGLVIRGWAPQVAVLRHRAVGAF 362

  Fly   373 INHAGKGGITESQYHGKPMLSLPVFADQPRNANAMV 408
            :.|.|...:.|:...|..||:.|:.|||..:|:.:|
plant   363 LTHCGWNSVVEAVVAGVLMLTWPMRADQYTDASLVV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 61/296 (21%)
UDPGT 37..526 CDD:278624 61/296 (21%)
UGT89B1NP_177529.2 PLN02863 4..473 CDD:215465 61/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.