DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT78D1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:371 Identity:75/371 - (20%)
Similarity:134/371 - (36%) Gaps:64/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GNKFDLVISGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAV 200
            |.|...:::..|. .|....|.::||..:.......|.|...|        |..:.....|.|.|
plant   110 GKKVTCMLTDAFF-WFAADIAAELNATWVAFWAGGANSLCAHL--------YTDLIRETIGLKDV 165

  Fly   201 TFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGND-----PK-MPEYSEMLKNTSLVFFSSHA 259
            :.:       ::|||  ...:...|.::..:||...|     || :.:.|..|...|.||.||..
plant   166 SME-------ETLGF--IPGMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFE 221

  Fly   260 ASEGPIRPNVPSAIE----------IGGIQIKDKPDPLPQNIAEFLGNATDGAI-LLSLGSNVQG 313
            ..|..:..|:.|.::          :.....|:..|  |.....::|..:..:: .:|.|:.::.
plant   222 ELEPTLNYNLRSKLKRFLNIAPLTLLSSTSEKEMRD--PHGCFAWMGKRSAASVAYISFGTVMEP 284

  Fly   314 KHLNPDTVAKMFNVLSKLKERVIWKWE------------DQENTPGKSANILYSKWLPQDDILAH 366
            .   |:.:..:...|...|...:|..:            |:....|     :...|.||.::|.|
plant   285 P---PEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGFLDRTREQG-----IVVPWAPQVELLKH 341

  Fly   367 PNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMV---KSGFGLTLSLLTLE--EKPF 426
            ..:.:.:.|.|...:.||...|.||:..|:.||...|..|:.   |.|..:...:.|.|  ||..
plant   342 EAMGVNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEKCL 406

  Fly   427 QEAILEILSNPQYAERVKSFSTLYRDRPM--TARESFLYWTEYVIR 470
            .:..:........|...|....|..|..|  ::.|:|....:.:::
plant   407 NDVFVHDDGKTMKANAKKLKEKLQEDFSMKGSSLENFKILLDEIVK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 75/371 (20%)
UDPGT 37..526 CDD:278624 75/371 (20%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 71/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.