DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT74E2

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_172059.1 Gene:UGT74E2 / 837075 AraportID:AT1G05680 Length:453 Species:Arabidopsis thaliana


Alignment Length:462 Identity:96/462 - (20%)
Similarity:164/462 - (35%) Gaps:160/462 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGANILGL-FPSLSPSHLIIQMSAAKVLAENGHNVTVVTVL-KP----VVNHKNITVIQVPLSKE 81
            :|::::.| ||  ...|:.......|.||..|..:|:|.|. ||    ...|.:|||..:....:
plant     3 EGSHLIVLPFP--GQGHITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPISNGFQ 65

  Fly    82 EAQQMSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGNKFDLVISGY 146
            |.::                     .:.|..|:|.|  .||.:.:.:..|.      .|:.:|| 
plant    66 EGEE---------------------PLQDLDDYMER--VETSIKNTLPKLV------EDMKLSG- 100

  Fly   147 FMNDFQLGFARKVNAP--VIVLATMPPNHLLNPLIGNPLEVSYA-GISNPAEGSKAVTFQR--RL 206
                         |.|  ::..:|||          ..|:|::: |:|.      ||.|.:  .:
plant   101 -------------NPPRAIVYDSTMP----------WLLDVAHSYGLSG------AVFFTQPWLV 136

  Fly   207 SSYMQSLGFGVFSHLSERRNRNWYKEVYGND-----PKMPEYSEMLKNTSLVFFSSHAASEGPIR 266
            ::....:..|.||..|.:         ||:.     |..|    ||....|..|...::|    .
plant   137 TAIYYHVFKGSFSVPSTK---------YGHSTLASFPSFP----MLTANDLPSFLCESSS----Y 184

  Fly   267 PNV-------PSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAILLSLGSNVQGKHLN------- 317
            ||:       .|.|:...|.:.:..|.|.:.:.:::.:...   :|::|..|...:|:       
plant   185 PNILRIVVDQLSNIDRVDIVLCNTFDKLEEKLLKWVQSLWP---VLNIGPTVPSMYLDKRLSEDK 246

  Fly   318 ----------------------PDTVA-------------KMFNVLSKLKER---VIWKWEDQEN 344
                                  |::|.             :|..:.:.||:.   .:|...:.|.
plant   247 NYGFSLFNAKVAECMEWLNSKEPNSVVYLSFGSLVILKEDQMLELAAGLKQSGRFFLWVVRETET 311

  Fly   345 TP---------GKSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQ 400
            ..         |:...|:  .|.||.|:|||.:|..|:.|.|.....|....|.||:.:|.:.||
plant   312 HKLPRNYVEEIGEKGLIV--SWSPQLDVLAHKSIGCFLTHCGWNSTLEGLSLGVPMIGMPHWTDQ 374

  Fly   401 PRNANAM 407
            |.||..|
plant   375 PTNAKFM 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 96/462 (21%)
UDPGT 37..526 CDD:278624 92/447 (21%)
UGT74E2NP_172059.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 95/459 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.