DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT72E2

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:456 Identity:86/456 - (18%)
Similarity:162/456 - (35%) Gaps:127/456 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVL-AENGHNVTV-------VTVLKPVVNHKNITVIQVPLSKEEAQQM 86
            :|.|....|:|..:...|.| |.||.:|||       .:.....:|...:.::::|        .
plant    10 MFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLP--------S 66

  Fly    87 SDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGNKFDLVISGYFMNDF 151
            .|..|.:..:|:....:.          :|.:.|...:..::..::    .|...:|...|..| 
plant    67 PDIYGLVDPDDHVVTKIG----------VIMRAAVPALRSKIAAMH----QKPTALIVDLFGTD- 116

  Fly   152 QLGFARKVNAPVIVLATMPPN------HLLNPLIGNPLEVSYAGISNP--AEGSKAVTFQRRLSS 208
            .|..|::.|  ::....:|.|      .:..|.:...::..:....||  ..|.:.|.|:..|.:
plant   117 ALCLAKEFN--MLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDA 179

  Fly   209 YM------------QSLGF----GVFSHLSERRNRNWYK-----EVYGNDPKMPEYSEMLKNTSL 252
            |:            ..|.:    |:..:..|.......|     ::.|...::|.|         
plant   180 YLVPDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVY--------- 235

  Fly   253 VFFSSHAASEGPI-RPNVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAIL-LSLGSNVQGKH 315
                    ..||: ||          ||..:...|    :.::|....:.::| :|.||   |..
plant   236 --------PIGPLCRP----------IQSSETDHP----VLDWLNEQPNESVLYISFGS---GGC 275

  Fly   316 LNPDTVAKMFNVLSKLKERVIWKWE------------------DQENTP----------GKSANI 352
            |:...:.::...|.:.::|.:|...                  .::|||          ......
plant   276 LSAKQLTELAWGLEQSQQRFVWVVRPPVDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGF 340

  Fly   353 LYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLS 417
            :...|.||.:||:|..:..|:.|.|.....||...|.||::.|:||:|..|| |::....|:.:.
plant   341 VVPSWAPQAEILSHRAVGGFLTHCGWSSTLESVVGGVPMIAWPLFAEQNMNA-ALLSDELGIAVR 404

  Fly   418 L 418
            |
plant   405 L 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 86/456 (19%)
UDPGT 37..526 CDD:278624 84/449 (19%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 86/456 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.