DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT76E2

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:510 Identity:107/510 - (20%)
Similarity:188/510 - (36%) Gaps:148/510 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNITVIQVPLSKEEAQQMSDTI-GAM 93
            |.|..:..|:...|...|.|...|.::||      |:...|    :|..||:.:.....|| |::
plant    13 LVPVPAQGHVTPMMQLGKALHSKGFSITV------VLTQSN----RVSSSKDFSDFHFLTIPGSL 67

  Fly    94 SKNDNSNMALS--LLRMSDQMDFMIRKNAETLMNDR--------VRDLYLNRGNKFDLVISGYF- 147
            :::|..|:...  :|:::...:...::....|::::        |.|.|:            || 
plant    68 TESDLQNLGPQKFVLKLNQICEASFKQCIGQLLHEQCNNDIACVVYDEYM------------YFS 120

  Fly   148 ---MNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQ-RRLSS 208
               :.:|||        |.:|.:|                            :.|..|. |.:.|
plant   121 HAAVKEFQL--------PSVVFST----------------------------TSATAFVCRSVLS 149

  Fly   209 YMQSLGF-----------GVFSHLSERRNRNWYKEVYGN-DPKMPEYSEML--KNTSLVFFSSHA 259
            .:.:..|           .||..|...|.::....|:|. :..:..|||.:  :..|.|..:|.:
plant   150 RVNAESFLIDMKDPETQDKVFPGLHPLRYKDLPTSVFGPIESTLKVYSETVNTRTASAVIINSAS 214

  Fly   260 ASEG------------PIRPNVPSAIEIGGIQI-KDKPDPL---PQNIAEFLG-NATDGAILLSL 307
            ..|.            |:.|       ||.:.| ...|..|   .::..|:|. ..::..|.:||
plant   215 CLESSSLARLQQQLQVPVYP-------IGPLHITASAPSSLLEEDRSCVEWLNKQKSNSVIYISL 272

  Fly   308 GSNVQGKHLNPDTVAKMFNVLSKLKERVIW----------KWEDQENTPGKSANILYS------K 356
            ||...   ::...:.:|...||...:..:|          :|  .|:.| :..|.|.|      |
plant   273 GSLAL---MDTKDMLEMAWGLSNSNQPFLWVVRPGSIPGSEW--TESLP-EEFNRLVSERGYIVK 331

  Fly   357 WLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKS-GFGLTLSLLT 420
            |.||.::|.||.:..|.:|.|.....||...|.||:..|...||..||..:.:. ..|:.|. ..
plant   332 WAPQMEVLRHPAVGGFWSHCGWNSTVESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQLE-GD 395

  Fly   421 LEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARESFLYWTEYVIRHHGAA 475
            |:::..:.|:..:|.:.:.||        .|.|.:..:|..    |..:|..|::
plant   396 LDKETVERAVEWLLVDEEGAE--------MRKRAIDLKEKI----ETSVRSGGSS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 107/510 (21%)
UDPGT 37..526 CDD:278624 105/503 (21%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 107/510 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.