DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT76E1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_200766.2 Gene:UGT76E1 / 836077 AraportID:AT5G59580 Length:453 Species:Arabidopsis thaliana


Alignment Length:494 Identity:100/494 - (20%)
Similarity:169/494 - (34%) Gaps:139/494 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVV-TVLKPVVNHKNIT---VIQVPLSKEEAQQMSDTI 90
            |.|..:..|:...|...|.|...|.::||| |....|.:.|:.:   .:.:|             
plant    12 LVPVPAQGHVTPIMQLGKALYSKGFSITVVLTQYNRVSSSKDFSDFHFLTIP------------- 63

  Fly    91 GAMSKNDNSNMALSLLRMSDQMDFMIRKN--AETLMNDRVRDLYLNRGNKFDLVISGYFM----- 148
            |:::::|..|:.        ...|:.:.|  .|......:..|...:||....|:...:|     
plant    64 GSLTESDLKNLG--------PFKFLFKLNQICEASFKQCIGQLLQEQGNDIACVVYDEYMYFSQA 120

  Fly   149 --NDFQL----------------GFARKVNAPVIVLATMPPNHL------LNPLIGNPLEVSYAG 189
              .:|||                ....:|||...:|....|...      |:||....|..|..|
plant   121 AVKEFQLPSVLFSTTSATAFVCRSVLSRVNAESFLLDMKDPKVSDKEFPGLHPLRYKDLPTSAFG 185

  Fly   190 ISNPAEGSKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKNTSLVF 254
               |.|                    .:....||..|......|..|.      :..|:::||.:
plant   186 ---PLE--------------------SILKVYSETVNIRTASAVIINS------TSCLESSSLAW 221

  Fly   255 FSSHAASEGPIRPNVPSAIEIGGIQI-KDKPDPL---PQNIAEFLGNATDGAIL-LSLGSNVQGK 314
            .....  :.|:.|       ||.:.| ...|..|   .::..|:|.....|::: :||||...  
plant   222 LQKQL--QVPVYP-------IGPLHIAASAPSSLLEEDRSCLEWLNKQKIGSVIYISLGSLAL-- 275

  Fly   315 HLNPDTVAKMFNVLSKLKERVIW----------KWEDQENTPGKSANILYS-----KWLPQDDIL 364
             :....:.:|...|....:..:|          :|  .|:.|.:.:.::..     ||.||.::|
plant   276 -METKDMLEMAWGLRNSNQPFLWVIRPGSIPGSEW--TESLPEEFSRLVSERGYIVKWAPQIEVL 337

  Fly   365 AHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKS-GFGLTLSLLTLEEKPFQE 428
            .||.:..|.:|.|.....||...|.||:..|...||..||..:.:. ..|:.|. ..|::...:.
plant   338 RHPAVGGFWSHCGWNSTLESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQLE-GELDKGTVER 401

  Fly   429 AILEILSNPQYAE------------------RVKSFSTL 449
            |:..::.:.:.||                  |..|||:|
plant   402 AVERLIMDEEGAEMRKRVINLKEKLQASVKSRGSSFSSL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 100/494 (20%)
UDPGT 37..526 CDD:278624 98/487 (20%)
UGT76E1NP_200766.2 Glycosyltransferase_GTB_type 1..450 CDD:299143 100/494 (20%)
YjiC 7..429 CDD:224732 95/481 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.