DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT5G54010

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_200212.1 Gene:AT5G54010 / 835484 AraportID:AT5G54010 Length:453 Species:Arabidopsis thaliana


Alignment Length:503 Identity:103/503 - (20%)
Similarity:189/503 - (37%) Gaps:143/503 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTV------------VTVLKPVVNHKNITVIQVPLSKEE 82
            :||.....|:...:..|..|||..|.:|.            :.:....:..:.:|:..|....:.
plant     9 MFPWFGFGHMTAFLHLANKLAEKDHKITFLLPKKARKQLESLNLFPDCIVFQTLTIPSVDGLPDG 73

  Fly    83 AQQMSD---TIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGNKFDLVIS 144
            |:..||   ::|       |.:|.::.|...|:     |.|.::             .|.||:  
plant    74 AETTSDIPISLG-------SFLASAMDRTRIQV-----KEAVSV-------------GKPDLI-- 111

  Fly   145 GYFMNDF---------QLGFARKVN------APVIV----------LATMPPNHLLNPLIGNPLE 184
             :|  ||         :.| .:.||      |.|.:          |.:.||.:..:.::....|
plant   112 -FF--DFAHWIPEIAREYG-VKSVNFITISAACVAISFVPGRSQDDLGSTPPGYPSSKVLLRGHE 172

  Fly   185 V-SYAGISNP-AEGSKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEML 247
            . |.:.:|.| .:|:   :|..|:     .:|......:|.|.    .:|:.|      ::.:.:
plant   173 TNSLSFLSYPFGDGT---SFYERI-----MIGLKNCDVISIRT----CQEMEG------KFCDFI 219

  Fly   248 KNTSLVFFSSHAASEGPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAIL-LSLGSNV 311
            :|.    |.......||:.|.            .|...||.....::|.....|::: .:|||.:
plant   220 ENQ----FQRKVLLTGPMLPE------------PDNSKPLEDQWRQWLSKFDPGSVIYCALGSQI 268

  Fly   312 -------QGKHLNPDTVAKMFNVL-------SKLKERVIWKWEDQENTPGKSANILYSKWLPQDD 362
                   |...|..:.....|.|.       |.::|.:...:|::.    |:..:::..|:.|..
plant   269 ILEKDQFQELCLGMELTGLPFLVAVKPPKGSSTIQEALPKGFEERV----KARGVVWGGWVQQPL 329

  Fly   363 ILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLSLLTLEEKP-- 425
            |||||:|..|::|.|.|.:.|:..:...::.:|...:|..|...|.:.   |.:|:....|:.  
plant   330 ILAHPSIGCFVSHCGFGSMWEALVNDCQIVFIPHLGEQILNTRLMSEE---LKVSVEVKREETGW 391

  Fly   426 FQEAILEILSNPQYAERVKSFSTLYRDRPM--TARESFLYWTEYVIRH 471
            |.:   |.||.   |.|    |.:.||..:  .||.:.:.|.|.::||
plant   392 FSK---ESLSG---AVR----SVMDRDSELGNWARRNHVKWKESLLRH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 103/503 (20%)
UDPGT 37..526 CDD:278624 101/496 (20%)
AT5G54010NP_200212.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 103/503 (20%)
MGT 8..409 CDD:273616 96/481 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.