DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT5G38040

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:429 Identity:79/429 - (18%)
Similarity:139/429 - (32%) Gaps:116/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVV----TVLKPVVNHKNITVIQVPLSKEEAQQMSDTI 90
            |.|..:..|:...:..||.|...|.::|||    ..|.|..:..:...:.:|             
plant    13 LVPVPAQGHITPMIQLAKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIP------------- 64

  Fly    91 GAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMN--DRVRDLYLNRGNKFDLVISGYFMNDFQL 153
                    .|:.:|.|:......|:|:...|..::  |.:..|.:|...:...||...||...::
plant    65 --------ENLPVSDLKNLGPGRFLIKLANECYVSFKDLLGQLLVNEEEEIACVIYDEFMYFVEV 121

  Fly   154 GFARKVNAPVIVLATMPPNHLLNPLI---------------GNPLEVS----------------- 186
            . .::.....::|:|......:...:               |...||.                 
plant   122 A-VKEFKLRNVILSTTSATAFVCRFVMCELYAKDGLAQLKEGGEREVELVPELYPIRYKDLPSSV 185

  Fly   187 YAGISNPAEGSKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKE-----VYGNDP-----KMP 241
            :|.:.:..|..|...::...||.:.:.     ....|..:..|.::     ||...|     ..|
plant   186 FASVESSVELFKNTCYKGTASSVIINT-----VRCLEMSSLEWLQQELEIPVYSIGPLHMVVSAP 245

  Fly   242 EYSEMLKNTSLVFFSSHAASEGPIRPNVPSAIEIGGIQIKDKPDPLP------QNIAEFLGNATD 300
            ..|.:.:|.|.:.:.:..      :|:....|.:|...:.:..:.|.      .:...||.....
plant   246 PTSLLEENESCIEWLNKQ------KPSSVIYISLGSFTLMETKEMLEMAYGFVSSNQHFLWVIRP 304

  Fly   301 GAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKERVIWKWEDQENTPGKSANILYSKWLPQDDILA 365
            |:|   .||.:..:.|              ||:.||            :......||.||..:||
plant   305 GSI---CGSEISEEEL--------------LKKMVI------------TDRGYIVKWAPQKQVLA 340

  Fly   366 HPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNA 404
            |..:..|.:|.|.....||...|.|::..|...||..||
plant   341 HSAVGAFWSHCGWNSTLESLGEGVPLICRPFTTDQKGNA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 79/429 (18%)
UDPGT 37..526 CDD:278624 77/422 (18%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 79/429 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.