DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT5G38010

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:437 Identity:94/437 - (21%)
Similarity:144/437 - (32%) Gaps:128/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVV----TVLKPVVNHKNITVIQVPLSKEEAQQMSDTI 90
            |.|:.:..|:...|..|:.|...|.::||.    ..|||..:..:...|.:|    |:...||. 
plant    13 LIPAPAQGHISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFITIP----ESLPASDL- 72

  Fly    91 GAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGNKFDLVISGYFMNDFQLGF 155
                  .|......||:::.:.:|..::....|:..:    .|....:...||...||. |....
plant    73 ------KNLGPVWFLLKLNKECEFSFKECLGQLLLQK----QLIPEEEIACVIYDEFMY-FAEAA 126

  Fly   156 ARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQRRLSSYMQSL------- 213
            |::.|.|.::.:|                            ..|..|..|  |.|..|       
plant   127 AKEFNLPKVIFST----------------------------ENATAFACR--SAMCKLYAKDGLA 161

  Fly   214 ----GFGVFSHLSERRNRNWYK--------------EVYGNDPKMPEYSEMLKNT-------SLV 253
                |.|....|..:.:...||              ||:.:.......|.|:.||       ||.
plant   162 PLKEGCGREEELVPKLHPLRYKDLPTSAFAPVEASVEVFKSSCDKGTASAMIINTVRCLEISSLE 226

  Fly   254 FFSSHAASEGPIRPNVPSAIEIGGIQIKDKPDP---LPQN--IAEFLGNATDGAIL-LSLGSNVQ 312
            :.....  :.||.|       ||.:.:.....|   |.:|  ..::|......::: :||||...
plant   227 WLQQEL--KIPIYP-------IGPLHMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSFTL 282

  Fly   313 GKHLNPDTVAKMFNVLSKLKERVIWKWEDQENTPGKSANILYS--------------------KW 357
               |....|.:|.:.|....:..:|...     ||   :||.|                    ||
plant   283 ---LETKEVLEMASGLVSSNQHFLWVIR-----PG---SILGSELTNEELLSMMEIPDRGYIVKW 336

  Fly   358 LPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNA 404
            .||..:|||..:..|.:|.|.....||...|.||:..|...||..||
plant   337 APQKQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 94/437 (22%)
UDPGT 37..526 CDD:278624 92/430 (21%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 94/437 (22%)
YjiC 8..433 CDD:224732 94/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.