DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT5G03490

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:426 Identity:83/426 - (19%)
Similarity:157/426 - (36%) Gaps:100/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVV------TVLKPVVN-H-KNITVIQVPLSKEEAQQM 86
            :||..:..||:..:.....|...|.||:|:      |.|.|::: | .::|.:..|.....:...
plant    22 VFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLSAHPSSVTSVVFPFPPHPSLSP 86

  Fly    87 S-DTIGAMSKNDNSNMALSLLRMSDQMD--FMIRKNAETLMNDRVRDLYLNRGNKFDLV------ 142
            . :.:..:..:.|..:..||.::.:.:.  |....|....:   :.|.:|  |...||.      
plant    87 GVENVKDVGNSGNLPIMASLRQLREPIINWFQSHPNPPIAL---ISDFFL--GWTHDLCNQIGIP 146

  Fly   143 ------ISGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPL-------EVSYAGISNPA 194
                  ||.:.::..|..|..     :.::.:..|.|||: |...|:       .:....:..|:
plant   147 RFAFFSISFFLVSVLQFCFEN-----IDLIKSTDPIHLLD-LPRAPIFKEEHLPSIVRRSLQTPS 205

  Fly   195 EGSKAV-TFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKNTSLVFFSSH 258
            ...::: .|...|.||     ..||:.                       ||:|::..|.:....
plant   206 PDLESIKDFSMNLLSY-----GSVFNS-----------------------SEILEDDYLQYVKQR 242

  Fly   259 AASE-----GPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAIL-LSLGSNVQGKHLN 317
            ...:     ||:       ..||. .:|.....:..::..:|..:.:|::| :..||.   |.|.
plant   243 MGHDRVYVIGPL-------CSIGS-GLKSNSGSVDPSLLSWLDGSPNGSVLYVCFGSQ---KALT 296

  Fly   318 PDTVAKMFNVLSKLKERVIW---------KWEDQENTPGKSANILYSKWLPQDDILAHPNIKLFI 373
            .|....:...|.|...|.:|         .:||:.:..|    ::...|:.|..:|.|..:..|:
plant   297 KDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRG----LVVRGWVSQLAVLRHVAVGGFL 357

  Fly   374 NHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVK 409
            :|.|...:.|....|..:|..|:.|||..||..:|:
plant   358 SHCGWNSVLEGITSGAVILGWPMEADQFVNARLLVE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 83/426 (19%)
UDPGT 37..526 CDD:278624 81/419 (19%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 83/426 (19%)
YjiC 19..447 CDD:224732 83/426 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.