DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT5G17040

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:311 Identity:63/311 - (20%)
Similarity:126/311 - (40%) Gaps:38/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 EVSYAGISNPAEGSKAVTFQRRLSSYMQSLG---FGVFSHLSERRNRNWYK-EVYGNDPKMPEYS 244
            |:..:.::....|::::....::||..|||.   .|..|.:.:.|.::..: .|:||...:  :|
plant   124 EMKVSWVAFWTSGTRSLLISTQISSEKQSLSKETLGCISGMEKIRVKDTPEGVVFGNLDSV--FS 186

  Fly   245 EMLKNTSL-------VFFSSHAASEGPIRPNV----PSAIEIGGIQI----KDKPDPL--PQN-I 291
            :||....|       |:.:|....:..:..|:    ...:.||.:.:    ..:..||  |.. :
plant   187 KMLHQMGLALPRATTVYMNSFEELDPTLTDNLRLKFKRYLSIGPLALLFSTSQRETPLHDPHGCL 251

  Fly   292 AEFLGNATDGAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKERVIWKWEDQE--NTP-----GKS 349
            |.....:|...:.::.|..:...   |..:..:...|...|...:|..:::.  :.|     |..
plant   252 AWIKKRSTASVVYIAFGRVMTPP---PGELVVVAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTR 313

  Fly   350 ANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAM-VKSGFG 413
            ...:...|.||.::|.|..:.:|::|.|...:.||...|.||:..|:|.|...||.:: .....|
plant   314 EQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIG 378

  Fly   414 LTLSLLTLEEKPFQEAILEIL---SNPQYAERVKSFSTLYRDRPMTARESF 461
            :|:|.....:..|:|::..:|   ...:.....|....|.::...|...||
plant   379 MTISSGVFTKDGFEESLDRVLVQDDGKKMKFNAKKLKELAQEAVSTEGSSF 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 63/311 (20%)
UDPGT 37..526 CDD:278624 63/311 (20%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 61/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.