DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT76C1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:488 Identity:106/488 - (21%)
Similarity:169/488 - (34%) Gaps:132/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVVTV---LKPVVNHKNITVIQVPLSKEEAQ-QMSDTI 90
            |||......:...:..||:|...|.::|::..   .....:|...|.:|:.....|:| |..|.:
plant    11 LFPLPLQGCINPMLQLAKILYSRGFSITIIHTRFNAPKSSDHPLFTFLQIRDGLSESQTQSRDLL 75

  Fly    91 GAMSKNDNSNMALSLLRMSDQMDF------MIRKNAETLMNDRVRDLYLNRGNKFDLVI--SGYF 147
                      :.|:||..:.|:.|      :|:.::::...||          |...||  ||:.
plant    76 ----------LQLTLLNNNCQIPFRECLAKLIKPSSDSGTEDR----------KISCVIDDSGWV 120

  Fly   148 MNDFQLGFARKVNAPVIVLATMP----PNHLLNPLIGN----PLEVSYAGISNP----------- 193
               |....|...|.|..||....    ..|.|.|.|..    |:..|.|....|           
plant   121 ---FTQSVAESFNLPRFVLCAYKFSFFLGHFLVPQIRREGFLPVPDSEADDLVPEFPPLRKKDLS 182

  Fly   194 -AEGSKAVTFQRRLSSYMQSL--------GFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKN 249
             ..|:.|.:  :.|.:|:..:        |..|.|          .||              |.:
plant   183 RIMGTSAQS--KPLDAYLLKILDATKPASGIIVMS----------CKE--------------LDH 221

  Fly   250 TSLVFFSSHAASEGPIRPNVPSAIEIGGIQIKDKP-------DPLPQNIAEFLG-NATDGAILLS 306
            .||.  .|:.....||.|       ||...|.|.|       :| .|:...:|. ..|...:.:|
plant   222 DSLA--ESNKVFSIPIFP-------IGPFHIHDVPASSSSLLEP-DQSCIPWLDMRETRSVVYVS 276

  Fly   307 LGSNVQGKHLNPDTVAKMFNVLSKLKERVIW----------KWED------QENTPGKSANILYS 355
            |||...   ||.....::...|....:..:|          .|.:      .|:..||...:   
plant   277 LGSIAS---LNESDFLEIACGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIV--- 335

  Fly   356 KWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLSLL- 419
            :|.||.|:|||.....|:.|.|.....||...|.||:.||...||..||. .:...:.:.:.|. 
plant   336 RWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNAR-FISEVWRVGIHLEG 399

  Fly   420 TLEEKPFQEAILEILSNPQYAERVKSFSTLYRD 452
            .:|.:..:.|::.::...: .|.::....:.||
plant   400 RIERREIERAVIRLMVESK-GEEIRGRIKVLRD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 106/488 (22%)
UDPGT 37..526 CDD:278624 103/481 (21%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 106/488 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.