DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT4G27560

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_194486.1 Gene:AT4G27560 / 828865 AraportID:AT4G27560 Length:455 Species:Arabidopsis thaliana


Alignment Length:427 Identity:86/427 - (20%)
Similarity:162/427 - (37%) Gaps:111/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVV---TVLKPVVN---------HKNITVIQV---PLS 79
            ::|..:..|:...:..|..|||.||.||.:   ..||.:.|         .:::||..|   |:.
plant    10 MYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVDGLPVG 74

  Fly    80 KEEAQQMSDTIGAMSKNDNSNMALSLLRMS-DQMDFMIRKNAETLMNDRVRDLYLNRGNKFDLVI 143
            .|...::..|        ::::.:|.:.:: ||::.::|.....|:             .||.  
plant    75 TETVSEIPVT--------SADLLMSAMDLTRDQVEGVVRAVEPDLI-------------FFDF-- 116

  Fly   144 SGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQRRLSS 208
             .:::.:....|..|....|:|.|:...:.|:.   |..|     |:..|...|..|..:::.:.
plant   117 -AHWIPEVARDFGLKTVKYVVVSASTIASMLVP---GGEL-----GVPPPGYPSSKVLLRKQDAY 172

  Fly   209 YMQSL----GFGVFSHLSERRNRNWY----------KEVYGNDPKMPEYSEMLKNTSLVFFSSHA 259
            .|::|    ...|..:|.||...:..          :|:.||   ..:|.|           .|.
plant   173 TMKNLESTNTINVGPNLLERVTTSLMNSDVIAIRTAREIEGN---FCDYIE-----------KHC 223

  Fly   260 ASE----GPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFL-GNATDGAILLSLGSNV-------Q 312
            ..:    ||:.|.            .||...|.:...::| |...|..:..:|||.|       |
plant   224 RKKVLLTGPVFPE------------PDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQ 276

  Fly   313 GKHLNPDTVAKMFNVL-------SKLKERVIWKWEDQENTPGKSANILYSKWLPQDDILAHPNIK 370
            ...|..:.....|.|.       |.::|.:...:|::.    |...:::.:|:.|..:|:||::.
plant   277 ELCLGMELTGSPFLVAVKPPRGSSTIQEALPEGFEERV----KGRGVVWGEWVQQPLLLSHPSVG 337

  Fly   371 LFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAM 407
            .|::|.|.|.:.||......::.:|...||..|...:
plant   338 CFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRLL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 86/427 (20%)
UDPGT 37..526 CDD:278624 85/420 (20%)
AT4G27560NP_194486.1 PLN02764 1..453 CDD:178364 86/427 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.