DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT71B5

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:474 Identity:95/474 - (20%)
Similarity:169/474 - (35%) Gaps:131/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILGLFPSLSPSHLIIQMSAAKV------LAENGHNVTVVTVLKPVVNHKN---ITVIQVPLSKEE 82
            :|.|.|::....:..|....|:      |...||....|.:.|.::..:|   ||:|.:| |:.:
plant    14 LLSLTPTIHSRKVRTQKQKMKIELVFIPLPGIGHLRPTVKLAKQLIGSENRLSITIIIIP-SRFD 77

  Fly    83 AQQMSDTIGA---MSKNDNSNM-ALSLLRMSDQMD-------FMIRKNAETLMNDRVRDLYLNRG 136
            |...|..|.:   :|::|..:. ::|:.:.....|       ..|.|. :|.:.|.|....::..
plant    78 AGDASACIASLTTLSQDDRLHYESISVAKQPPTSDPDPVPAQVYIEKQ-KTKVRDAVAARIVDPT 141

  Fly   137 NKFDLVISGYFMNDF---QLGFARKVNAPVIVLATMPPNHL----------------LNPLIGNP 182
            .|    ::|:.::.|   .:..|.:...|..::.|.....|                ::.|..:.
plant   142 RK----LAGFVVDMFCSSMIDVANEFGVPCYMVYTSNATFLGTMLHVQQMYDQKKYDVSELENSV 202

  Fly   183 LEVSYAGISNP------------AEGSKAVTFQRRLSSYMQSLGFGVFSHLSERR------NRNW 229
            .|:.:..::.|            .|.......|.|....|:.:.....:.|....      |.:.
plant   203 TELEFPSLTRPYPVKCLPHILTSKEWLPLSLAQARCFRKMKGILVNTVAELEPHALKMFNINGDD 267

  Fly   230 YKEVY----------GNDPKMPEYSEMLK------NTSLVF--FSSHAASEGPIRPNVPSAIEIG 276
            ..:||          |||.. .:.||:|:      :.|:||  |.|                 :|
plant   268 LPQVYPVGPVLHLENGNDDD-EKQSEILRWLDEQPSKSVVFLCFGS-----------------LG 314

  Fly   277 GI---QIKDKPDPLPQNIAEFLGNATDGAILLSLGSNVQGKHLNP----DTVAKMFNVLSKLKER 334
            |.   |.::....|.::...||...               :|.:|    |......|:...|.|.
plant   315 GFTEEQTRETAVALDRSGQRFLWCL---------------RHASPNIKTDRPRDYTNLEEVLPEG 364

  Fly   335 VIWKWEDQENTPGKSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFAD 399
            .:.:..|:....|         |.||..:|..|.|..|:.|.|...|.||.:.|.||::.|::|:
plant   365 FLERTLDRGKVIG---------WAPQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLYAE 420

  Fly   400 QPRNANAMVKSGFGLTLSL 418
            |..||..||:. .||.:.:
plant   421 QKVNAFEMVEE-LGLAVEI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 95/474 (20%)
UDPGT 37..526 CDD:278624 92/464 (20%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.