DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT73D1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_190883.2 Gene:UGT73D1 / 824481 AraportID:AT3G53150 Length:516 Species:Arabidopsis thaliana


Alignment Length:482 Identity:99/482 - (20%)
Similarity:178/482 - (36%) Gaps:118/482 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNITVIQVPLSKEEAQQMSDTIGAMS 94
            |.|.::..|||..:..:|:||..|:.||:||                  :.:.|.:.:.|:....
plant    25 LIPLMAQGHLIPMVDISKILARQGNIVTIVT------------------TPQNASRFAKTVDRAR 71

  Fly    95 KNDNSNMALSLLRMS-DQMDFMIRKNAETL----MNDRVRDLY---------LNRGNKFDLVISG 145
            .  .|.:.:::::.. ...:|.:.|:.|||    ..|.:|..|         :.|..:...:...
plant    72 L--ESGLEINVVKFPIPYKEFGLPKDCETLDTLPSKDLLRRFYDAVDKLQEPMERFLEQQDIPPS 134

  Fly   146 YFMNDFQLGF----ARKVNAPVIVLATMPPNHLLN--------------------PLIGNPLEVS 186
            ..::|..|.:    |::...|.||...|....||:                    |:.|.|..:.
plant   135 CIISDKCLFWTSRTAKRFKIPRIVFHGMCCFSLLSSHNIHLHSPHLSVSSAVEPFPIPGMPHRIE 199

  Fly   187 YAGISNPAEGSKAVTFQ--RRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPE-YSEMLK 248
            .|....|....|.....  |......:|..|||..        |.::|:   :|...| |:|.:.
plant   200 IARAQLPGAFEKLANMDDVREKMRESESEAFGVIV--------NSFQEL---EPGYAEAYAEAIN 253

  Fly   249 NTSLVFFSSHAASEGPIRPNVPSAIEI------GGIQIKDKPDPLPQNIAEFLGNATDGAIL-LS 306
            ..  |:|      .||:........::      |.|.|.:      ....:||.:....::| :|
plant   254 KK--VWF------VGPVSLCNDRMADLFDRGSNGNIAISE------TECLQFLDSMRPRSVLYVS 304

  Fly   307 LGSNVQGKHLNPDTVAKMFNVLSKLKERVIW-------------KWEDQENTPG--KSANILYSK 356
            |||..:   |.|:.:.::...|.:..:..||             :|..:||...  :...|:...
plant   305 LGSLCR---LIPNQLIELGLGLEESGKPFIWVIKTEEKHMIELDEWLKRENFEERVRGRGIVIKG 366

  Fly   357 WLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLSLLTL 421
            |.||..||:|.:...|:.|.|.....|:...|.||::.|:||:|..|...:|:.   |.:.:...
plant   367 WSPQAMILSHGSTGGFLTHCGWNSTIEAICFGVPMITWPLFAEQFLNEKLIVEV---LNIGVRVG 428

  Fly   422 EEKPF----QEAILEILSNPQYAERVK 444
            .|.|.    :|.:..::..|...:.:|
plant   429 VEIPVRWGDEERLGVLVKKPSVVKAIK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 99/482 (21%)
UDPGT 37..526 CDD:278624 97/475 (20%)
UGT73D1NP_190883.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.