DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT72E1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:511 Identity:99/511 - (19%)
Similarity:183/511 - (35%) Gaps:142/511 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGLFPSLSPSHLIIQMSAAKVLA-ENGHNVTVVTVLKPVVNHKNITVIQVPLSKEEAQQMS---- 87
            :.:|.|....|:|..:...|.|| .:|.:||             |.|::...:..::|.::    
plant     8 VAMFASPGMGHIIPVIELGKRLAGSHGFDVT-------------IFVLETDAASAQSQFLNSPGC 59

  Fly    88 -----DTIGAMSKNDNSNM-------ALSLLRMSDQMDFMIRKNAETLMND---RVRDLY----L 133
                 |.:| :...|.|.:       .:.||.|..:....||...|.:.:.   .:.||:    :
plant    60 DAALVDIVG-LPTPDISGLVDPSAFFGIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAI 123

  Fly   134 NRGNKFDLVISGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNP--AEG 196
            ..|.:|:::...:..:          ||..:.:|      |..|.:...:|..:.....|  ..|
plant   124 PLGGEFNMLTYIFIAS----------NARFLAVA------LFFPTLDKDMEEEHIIKKQPMVMPG 172

  Fly   197 SKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKNTSLVFFSSHAAS 261
            .:.|.|:..|.:::..             |...|:|........|....::.||           
plant   173 CEPVRFEDTLETFLDP-------------NSQLYREFVPFGSVFPTCDGIIVNT----------- 213

  Fly   262 EGPIRPNVPSAIE-------IGGIQI-----KDKP-DPLPQN--IAEFLGNATDGAIL-LSLGSN 310
            ...:.|....:::       |.|:.:     ..:| ||...|  :.::|....|.::| :|.|| 
plant   214 WDDMEPKTLKSLQDPKLLGRIAGVPVYPIGPLSRPVDPSKTNHPVLDWLNKQPDESVLYISFGS- 277

  Fly   311 VQGKHLNPDTVAKMFNVLSKLKERVIW------------------KWEDQENTPG---------- 347
              |..|:...:.::...|...::|.:|                  ..:.::.||.          
plant   278 --GGSLSAKQLTELAWGLEMSQQRFVWVVRPPVDGSACSAYLSANSGKIRDGTPDYLPEGFVSRT 340

  Fly   348 KSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGF 412
            .....:.|.|.||.:||||..:..|:.|.|...|.||...|.||::.|:||:|..|| .::....
plant   341 HERGFMVSSWAPQAEILAHQAVGGFLTHCGWNSILESVVGGVPMIAWPLFAEQMMNA-TLLNEEL 404

  Fly   413 GLTL--------SLLTLEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARES 460
            |:.:        .::|..|  .:..:.:|:...:.||..|....|..    ||.||
plant   405 GVAVRSKKLPSEGVITRAE--IEALVRKIMVEEEGAEMRKKIKKLKE----TAAES 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 99/511 (19%)
UDPGT 37..526 CDD:278624 97/502 (19%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 99/511 (19%)
YjiC 5..479 CDD:224732 99/511 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.