DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT3G46690

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:508 Identity:94/508 - (18%)
Similarity:178/508 - (35%) Gaps:131/508 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLRVEKFLLLAIAIGAVMGSSQGANILGLFPSLSPSHLIIQMSAAKVLAENGHNVTVV-----T 60
            |..||||..::.:.:.|     ||             |:...|...|.|...|..:||.     .
plant     1 MEKRVEKRRIVLVPVAA-----QG-------------HVTPMMQLGKALQSKGFLITVAQRQFNQ 47

  Fly    61 VLKPVVNHKNITVIQVP--LSKEEAQQMSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETL 123
            :...:.:......:.:|  |.:.|::::......|:.|                     |.:|..
plant    48 IGSSLQHFPGFDFVTIPESLPQSESKKLGPAEYLMNLN---------------------KTSEAS 91

  Fly   124 MNDRVRDLYLNRGNKFDLVISGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYA 188
            ..:.:..|.:.:||....:|....|. |....|::...|.::.:|....          ::|.|.
plant    92 FKECISQLSMQQGNDIACIIYDKLMY-FCEAAAKEFKIPSVIFSTSSAT----------IQVCYC 145

  Fly   189 GIS------------NPAEGSKAVTFQRRLS-SYMQSLGFGVFSHLSER----RNRNWYKEVYGN 236
            .:|            :|.:..|.:.....|. ..:.:.|||....|.|.    .|:.....|..|
plant   146 VLSELSAEKFLIDMKDPEKQDKVLEGLHPLRYKDLPTSGFGPLEPLLEMCREVVNKRTASAVIIN 210

  Fly   237 DPKMPEYSEMLKNTSLVFFSSHAASEGPIRPNVPSAIEIGGIQI-KDKPDP--LPQNIA--EFLG 296
            .      :..|::.||.:.......  |:.|       :|.:.| ...|.|  |.::::  |:|.
plant   211 T------ASCLESLSLSWLQQELGI--PVYP-------LGPLHITASSPGPSLLQEDMSCIEWLN 260

  Fly   297 NATDGAIL-LSLGSNVQGKHLNPDTVAKMFNVLSKLKERVIWKWEDQENTPGKSANILY------ 354
            .....::: :|||:..   |:....:.:|...|....:..:|...     ||..|...:      
plant   261 KQKPRSVIYISLGTKA---HMETKEMLEMAWGLLNSNQPFLWVIR-----PGSVAGFEWIELLPE 317

  Fly   355 ------------SKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAM 407
                        :||.||.::|.||.:..|.:|.|.....||...|.||:..|:..:|..|| ..
plant   318 EVIKMVTERGYIAKWAPQIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRPLQGEQKLNA-MY 381

  Fly   408 VKSGFGLTLSLL-TLEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARE 459
            ::|.:.:.:.|. .:|.:..:.|:..::.:.:.|        ..|:|.:..:|
plant   382 IESVWKIGIQLEGEVEREGVERAVKRLIIDEEGA--------AMRERALDLKE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 94/508 (19%)
UDPGT 37..526 CDD:278624 86/472 (18%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 94/508 (19%)
YjiC 7..431 CDD:224732 90/502 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.