DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT76E11

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:424 Identity:87/424 - (20%)
Similarity:147/424 - (34%) Gaps:122/424 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HLIIQMSAAKVLAENGHNVTVV----TVLKPVVNHKNITVIQVPLSKEEAQQMSDTIGAMSKNDN 98
            |:...|..||.|...|.::|:.    ....|..:..:...:.:|.|..|:.  .:.:|       
plant    20 HISPIMQLAKTLHLKGFSITIAQTKFNYFSPSDDFTDFQFVTIPESLPESD--FEDLG------- 75

  Fly    99 SNMALSLLRMSDQMDFM--IRKNAETLMNDRVRDLYLNRGNKFDLVISGYFMNDFQLGFARKVNA 161
                        .::|:  :.|..:....|.:..|.|.:||:...|:...||. |....|::...
plant    76 ------------PIEFLHKLNKECQVSFKDCLGQLLLQQGNEIACVVYDEFMY-FAEAAAKEFKL 127

  Fly   162 PVIVLAT--------------MPPNHLLNPLIG------------NPLEVSYAGISNPAEGSKAV 200
            |.::.:|              :..|.:|.||..            :||......:|:.|.     
plant   128 PNVIFSTTSATAFVCRSAFDKLYANSILTPLKEPKGQQNELVPEFHPLRCKDFPVSHWAS----- 187

  Fly   201 TFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKNTSLVFFSSHAAS---- 261
                 |.|.|                     |:|.|.......|.::.||:....||..:.    
plant   188 -----LESMM---------------------ELYRNTVDKRTASSVIINTASCLESSSLSRLQQQ 226

  Fly   262 -EGPIRPNVPSAIEIGGIQI--KDKPDPLPQN--IAEFLG-NATDGAILLSLGSNVQGKHLNPDT 320
             :.|:.|       ||.:.:  ......|.:|  ..|:|. ...:..|.:||||...   :..:.
plant   227 LQIPVYP-------IGPLHLVASASTSLLEENKSCIEWLNKQKKNSVIFVSLGSLAL---MEINE 281

  Fly   321 VAKMFNVLSKLKERVIW----------KWEDQENTPGKSANILYS-----KWLPQDDILAHPNIK 370
            |.:....|...|::.:|          :|  .||.|.:.:.|:..     ||.||.::|:||.:.
plant   282 VIETALGLDSSKQQFLWVIRPGSVRGSEW--IENLPKEFSKIISGRGYIVKWAPQKEVLSHPAVG 344

  Fly   371 LFINHAGKGGITESQYHGKPMLSLPVFADQPRNA 404
            .|.:|.|.....||...|.||:..|..:||..||
plant   345 GFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 87/424 (21%)
UDPGT 37..526 CDD:278624 87/424 (21%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 87/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.