DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and HYR1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:454 Identity:89/454 - (19%)
Similarity:168/454 - (37%) Gaps:92/454 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NGHNVTVVTVLKPVV---NHKNITVIQVP-LSKEEAQQMSDTIGAMSKNDNSNMALSLLRMSDQM 112
            :||...:|.|.|..|   :|.:||:|.:| :....:...|..|.::|.:....::.::|.:.|:.
plant    13 DGHLRPLVEVAKLHVDRDDHLSITIIIIPQMHGFSSSNSSSYIASLSSDSEERLSYNVLSVPDKP 77

  Fly   113 DF----------------MIRKNAETLMNDRVRDLYLNRGNKFDLVISGYFMNDF---QLGFARK 158
            |.                .::...|.|.:....|....        ::|:.::.|   .:..|.:
plant    78 DSDDTKPHFFDYIDNFKPQVKATVEKLTDPGPPDSPSR--------LAGFVVDMFCMMMIDVANE 134

  Fly   159 VNAPVIVLATMPPNHLLNPLIGNPLEVSYA-GISN--PAEGSKAVTFQRRLSSYMQSLGFGVFSH 220
            ...|..:..|.....|     |..:.|.|. .:.|  .::...:.|.:..:....:.|....|. 
plant   135 FGVPSYMFYTSNATFL-----GLQVHVEYLYDVKNYDVSDLKDSDTTELEVPCLTRPLPVKCFP- 193

  Fly   221 LSERRNRNWYKEVYGNDPKMPEYSEMLKNT-------SLVFFSSHAASEGPIRPNVPSAIEIGGI 278
             |....:.|...::....:..|...:|.||       ::.|||   ..:.|: |.|.:...:..:
plant   194 -SVLLTKEWLPVMFRQTRRFRETKGILVNTFAELEPQAMKFFS---GVDSPL-PTVYTVGPVMNL 253

  Fly   279 QIK--DKPDPLPQNIAEFLGNATDGAILL----SLGSNVQGKHLNPDTVAKMFNV-LSKLKERVI 336
            :|.  :..|.....|..:|......:::.    |:|...:|:       ||...: |.:...|.:
plant   254 KINGPNSSDDKQSEILRWLDEQPRKSVVFLCFGSMGGFREGQ-------AKEIAIALERSGHRFV 311

  Fly   337 WKWEDQE-----NTPGKSANI----------------LYSKWLPQDDILAHPNIKLFINHAGKGG 380
            |.....:     ..|.:..|:                ....|.||..|||:|.|..|::|.|...
plant   312 WSLRRAQPKGSIGPPEEFTNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNS 376

  Fly   381 ITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLSLLTLEEKPFQEAILEILSNPQYAERVK 444
            ..||.:.|.||.:.|::|:|..||..||:. .||.:.:.......|..|..|:::    ||.::
plant   377 TLESLWFGVPMATWPLYAEQQVNAFEMVEE-LGLAVEVRNSFRGDFMAADDELMT----AEEIE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 89/454 (20%)
UDPGT 37..526 CDD:278624 89/454 (20%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 89/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.