DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT74F1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_181912.1 Gene:UGT74F1 / 818988 AraportID:AT2G43840 Length:449 Species:Arabidopsis thaliana


Alignment Length:160 Identity:40/160 - (25%)
Similarity:69/160 - (43%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 IRPNVPSAIEIGGIQIKDKPDPLPQNI---------AEFLGNATDGAIL-LSLGSNVQGKHLNPD 319
            |.|.|||...  ..|||...| ...|:         .::|....:|::: ::.||..:   |:.:
plant   222 IGPTVPSMYL--DQQIKSDND-YDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAK---LSSE 280

  Fly   320 TVAKMFNVLSKLKERVIWKW-----EDQENTPGKSANI-----LYSKWLPQDDILAHPNIKLFIN 374
            .:.::.:.:|...    :.|     |:.:..||....:     |..||.||..:|::..|..|:.
plant   281 QMEEIASAISNFS----YLWVVRASEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMT 341

  Fly   375 HAGKGGITESQYHGKPMLSLPVFADQPRNA 404
            |.|.....|....|.||:::|.:.|||.||
plant   342 HCGWNSTMEGLSLGVPMVAMPQWTDQPMNA 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 40/160 (25%)
UDPGT 37..526 CDD:278624 40/160 (25%)
UGT74F1NP_181912.1 PLN02173 1..449 CDD:177830 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.