DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT74D1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001325305.1 Gene:UGT74D1 / 817732 AraportID:AT2G31750 Length:490 Species:Arabidopsis thaliana


Alignment Length:446 Identity:100/446 - (22%)
Similarity:154/446 - (34%) Gaps:128/446 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MGSSQGANILGL-FPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNIT-------VIQ 75
            ||....||:|.. ||.....:.::|.|  |.|.....|||.:|...   .|.:|.       ...
plant     1 MGEKAKANVLVFSFPIQGHINPLLQFS--KRLLSKNVNVTFLTTSS---THNSILRRAITGGATA 60

  Fly    76 VPLS-------KEEAQQMSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYL 133
            :|||       .||....:||..........|::.||..:...||  .:.||  ::.|......|
plant    61 LPLSFVPIDDGFEEDHPSTDTSPDYFAKFQENVSRSLSELISSMD--PKPNA--VVYDSCLPYVL 121

  Fly   134 NRGNKFDLVISGYFMNDFQLGFARKVNAPVI--------------VLATMPPNHLLNPLIGNPLE 184
            :...|...|.:..|...     :..|||..|              ||..||      ||.||.|.
plant   122 DVCRKHPGVAAASFFTQ-----SSTVNATYIHFLRGEFKEFQNDVVLPAMP------PLKGNDLP 175

  Fly   185 VSY--AGISNPAEGSKAVTFQRRLSSY--MQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSE 245
            |..  ..:..|       .|:...|.:  :..:.|.:.:...|       .||        |..:
plant   176 VFLYDNNLCRP-------LFELISSQFVNVDDIDFFLVNSFDE-------LEV--------EVLQ 218

  Fly   246 MLKNTSLVFFSSHAASEGPIR---PNVPS-------------AIEIGGIQIKDKPDPLPQNIAEF 294
            .:||            :.|::   |.:||             .|.:...|:.:        ..::
plant   219 WMKN------------QWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNE--------CLDW 263

  Fly   295 LGNATDGAIL-LSLGSNVQGKHLNPDTVAKMFNVLSKLKE---RVIWKWEDQENTPGKSANI--- 352
            |.:...|::: :|.||...   |..|   :|..|.:.||:   ..:|...:.|.....|..|   
plant   264 LDSKPPGSVIYVSFGSLAV---LKDD---QMIEVAAGLKQTGHNFLWVVRETETKKLPSNYIEDI 322

  Fly   353 ----LYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNA 404
                |...|.||..:|||.:|..|:.|.|.....|:...|..::.:|.::|||.||
plant   323 CDKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEALSLGVALIGMPAYSDQPTNA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 100/446 (22%)
UDPGT 37..526 CDD:278624 93/427 (22%)
UGT74D1NP_001325305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.