DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and AT2G30150

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:460 Identity:104/460 - (22%)
Similarity:171/460 - (37%) Gaps:101/460 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNH-KNITVIQVPLSKEEAQQMSDTIGAMSKND 97
            :.|..|.::...|......||...::.:.|.:|.. .|:||..|     ..::....||:..|.:
plant     4 IKPQPLGVRHVVAMPWPGRGHINPMLNLCKSLVRRDPNLTVTFV-----VTEEWLGFIGSDPKPN 63

  Fly    98 NSNMAL-------SLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGNK--FDLVISGYFMNDFQL 153
            ..:.|.       .|:|.:|.:.|:   :|.....:...:..|:|.|.  ..::...|.:...::
plant    64 RIHFATLPNIIPSELVRANDFIAFI---DAVLTRLEEPFEQLLDRLNSPPTAIIADTYIIWAVRV 125

  Fly   154 GFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQ----------RRLSS 208
            |..|  |.||....|.... :|:..|.:.|..|:...  |.|.|::...:          .|||.
plant   126 GTKR--NIPVASFWTTSAT-ILSLFINSDLLASHGHF--PIEPSESKLDEIVDYIPGLSPTRLSD 185

  Fly   209 YMQSLGFG--VFSHLSERRNRNWYKEVYGNDPK-----MPEYSEMLKNTSLVFFSSH----AASE 262
            .....|:.  ||         |.:|:.:|...|     .|...| |:..::.||:|.    ..|.
plant   186 LQILHGYSHQVF---------NIFKKSFGELYKAKYLLFPSAYE-LEPKAIDFFTSKFDFPVYST 240

  Fly   263 GPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAIL-LSLGSNVQGKHLNPDTV----- 321
            ||:.|  ...:.:|.       :....:..::|....:.::| :|.||.:.......:.:     
plant   241 GPLIP--LEELSVGN-------ENRELDYFKWLDEQPESSVLYISQGSFLSVSEAQMEEIVVGVR 296

  Fly   322 ---AKMFNVLS----KLKERVIWKWEDQENTPGKSANILYSKWLPQDDILAHPNIKLFINHAGKG 379
               .|.|.|..    ||||.:       |.:.|     :...|..|..:|.|..|..|..|.|..
plant   297 EAGVKFFWVARGGELKLKEAL-------EGSLG-----VVVSWCDQLRVLCHAAIGGFWTHCGYN 349

  Fly   380 GITESQYHGKPMLSLPVFADQPRNANAMVKS---GFGLTLSLLTLEEKPFQEAILEILSNPQYAE 441
            ...|....|.|:|:.|||.||..||..:|:.   |.|       :|.|...|  |.|:|: :..|
plant   350 STLEGICSGVPLLTFPVFWDQFLNAKMIVEEWRVGMG-------IERKKQME--LLIVSD-EIKE 404

  Fly   442 RVKSF 446
            .||.|
plant   405 LVKRF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 104/460 (23%)
UDPGT 37..526 CDD:278624 103/457 (23%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 102/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.