DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT87A2

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:414 Identity:93/414 - (22%)
Similarity:172/414 - (41%) Gaps:74/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSLSP----SHLIIQMSAAKVLAENGHNVTVVTVLKPVV-NHKNITVIQVPLSKEEAQQMSDTIG 91
            |:.||    .|::     |......||...::.:.|.:| .:.|:.|..|     ..::....||
plant     3 PNESPPNQFRHVV-----AMPYPGRGHINPMMNLCKRLVRRYPNLHVTFV-----VTEEWLGFIG 57

  Fly    92 AMSKNDNSNMAL-------SLLRMSDQMDFM------IRKNAETLMNDRVRDLYLNRGNKFDLVI 143
            ...|.|..:.:.       .|:|..|.:.|:      :.:..|.|::.      ||......:..
plant    58 PDPKPDRIHFSTLPNLIPSELVRAKDFIGFIDAVYTRLEEPFEKLLDS------LNSPPPSVIFA 116

  Fly   144 SGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYA-GISNPAEGSKAVTFQRRLS 207
            ..|.:...::|  ||.|.||:.|.||... :|:..:.:.|.:|:. .:..|:| .:.|.:...||
plant   117 DTYVIWAVRVG--RKRNIPVVSLWTMSAT-ILSFFLHSDLLISHGHALFEPSE-EEVVDYVPGLS 177

  Fly   208 -SYMQSLGFGVFSHLSER---RNRNWYKEVYGNDPKMPEYSEMLKNTSLVFFSSH----AASEGP 264
             :.::.|. .:|...|:|   ..:..:.|:.|....:...:..|::.::..|:|.    ..:.||
plant   178 PTKLRDLP-PIFDGYSDRVFKTAKLCFDELPGARSLLFTTAYELEHKAIDAFTSKLDIPVYAIGP 241

  Fly   265 IRPNVPSAIEIGGIQIKDKPDPLPQNIAEFLGNATDGAIL-LSLGSNVQGKHLNPDTVAKMFNVL 328
            :.|....:::      .|..:|   |..::|....:|::| :|.||.:....      |:|..::
plant   242 LIPFEELSVQ------NDNKEP---NYIQWLEEQPEGSVLYISQGSFLSVSE------AQMEEIV 291

  Fly   329 SKLKE---RVIW-----KWEDQENTPGKSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQ 385
            ..|:|   |.:|     :.:.:|...| |..::.| |..|..:|.|..:..|..|.|.....|..
plant   292 KGLRESGVRFLWVARGGELKLKEALEG-SLGVVVS-WCDQLRVLCHKAVGGFWTHCGFNSTLEGI 354

  Fly   386 YHGKPMLSLPVFADQPRNANAMVK 409
            |.|.|||:.|:|.||..||..:|:
plant   355 YSGVPMLAFPLFWDQILNAKMIVE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 93/414 (22%)
UDPGT 37..526 CDD:278624 90/405 (22%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 93/414 (22%)
YjiC 13..450 CDD:224732 90/404 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.