DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT76D1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_180216.1 Gene:UGT76D1 / 817189 AraportID:AT2G26480 Length:452 Species:Arabidopsis thaliana


Alignment Length:438 Identity:86/438 - (19%)
Similarity:148/438 - (33%) Gaps:130/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNIT----VIQVPLSKEEAQQMSDTI 90
            :.|:....||...|:.|..|:..|.::|:|   :...|.|:|:    .|:....|:         
plant    11 MVPAPFQGHLPSMMNLASYLSSQGFSITIV---RNEFNFKDISHNFPGIKFFTIKD--------- 63

  Fly    91 GAMSKNDNSNMALSLLRMSDQMDFMIRKNA--ETLMNDRVRDLYLNRGNKFDLVISGYFMNDFQL 153
             .:|::|..::.|        ::|::..|:  |.|:    ::...|..:..|.:|...|:. |..
plant    64 -GLSESDVKSLGL--------LEFVLELNSVCEPLL----KEFLTNHDDVVDFIIYDEFVY-FPR 114

  Fly   154 GFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQRRLSSYMQSLGFGVF 218
            ..|..:|.|.:|.                           :..|.|.:..|.:....||.|.   
plant   115 RVAEDMNLPKMVF---------------------------SPSSAATSISRCVLMENQSNGL--- 149

  Fly   219 SHLSERRNRNWYKEVYGNDPKMPE-------------YSEMLKNTSLVFFSSHAASEGPIRPNVP 270
              |..:..|:..:|.      :||             |..|.:...|....|:.||...|..|..
plant   150 --LPPQDARSQLEET------VPEFHPFRFKDLPFTAYGSMERLMILYENVSNRASSSGIIHNSS 206

  Fly   271 SAIE-----------------IGGIQIKDKPDPLP------QNIAEFL-GNATDGAILLSLGSNV 311
            ..:|                 :|.:.:.:.....|      :|..|:| ...|...|.:|:||..
plant   207 DCLENSFITTAQEKWGVPVYPVGPLHMTNSAMSCPSLFEEERNCLEWLEKQETSSVIYISMGSLA 271

  Fly   312 QGKHLNPDTVAKMFNVLSKLKERVIW-----------------KWEDQENTPGKSANILYSKWLP 359
            ..:.:....:|..|   .:..:..:|                 :..:|..|.|:...:   ||.|
plant   272 MTQDIEAVEMAMGF---VQSNQPFLWVIRPGSINGQESLDFLPEQFNQTVTDGRGFVV---KWAP 330

  Fly   360 QDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAM 407
            |.::|.|..:..|.||.|.....||...|.||:..|...||..|...|
plant   331 QKEVLRHRAVGGFWNHGGWNSCLESISSGVPMICRPYSGDQRVNTRLM 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 86/438 (20%)
UDPGT 37..526 CDD:278624 85/431 (20%)
UGT76D1NP_180216.1 Glycosyltransferase_GTB-type 6..445 CDD:415824 86/438 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.