DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT84B1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:475 Identity:97/475 - (20%)
Similarity:166/475 - (34%) Gaps:141/475 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MGSSQGANILGLFPSLS-PSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNITVIQVPLSKEE 82
            ||||:|.....|..:|. ..|:...:..||.|:.:..|:           |.|:..|      |.
plant     1 MGSSEGQETHVLMVTLPFQGHINPMLKLAKHLSLSSKNL-----------HINLATI------ES 48

  Fly    83 AQQMSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMN--DRVRDLYLNR---GNKFDLV 142
            |:.:..|:      :.....:.|:..||.:.....|..|||:.  ::|..:.|::   ..::..:
plant    49 ARDLLSTV------EKPRYPVDLVFFSDGLPKEDPKAPETLLKSLNKVGAMNLSKIIEEKRYSCI 107

  Fly   143 ISGYFMNDFQLGFARKVNAPVIVL------------------ATMPPNHLLNPLIGNP----LEV 185
            ||..| ..:....|...|....:|                  .:.|....||..:..|    |||
plant   108 ISSPF-TPWVPAVAASHNISCAILWIQACGAYSVYYRYYMKTNSFPDLEDLNQTVELPALPLLEV 171

  Fly   186 SYAGISNPAEGSKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEMLKNT 250
                              |.|.|:|...|...|.:|                  |.|:::.|:..
plant   172 ------------------RDLPSFMLPSGGAHFYNL------------------MAEFADCLRYV 200

  Fly   251 SLVFFSSHAASEGPI-------RPNVPSAIEIGGIQIKD-KPDPLPQNIAEFLGN---------- 297
            ..|..:|....|..|       :|.:|....:....:.| :.:.|.....:|..:          
plant   201 KWVLVNSFYELESEIIESMADLKPVIPIGPLVSPFLLGDGEEETLDGKNLDFCKSDDCCMEWLDK 265

  Fly   298 -ATDGAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKER---VIWKWEDQENTPGKSANI------ 352
             |....:.:|.||.::......:|:||      .||.|   .:|....:|    |:.|:      
plant   266 QARSSVVYISFGSMLETLENQVETIAK------ALKNRGLPFLWVIRPKE----KAQNVAVLQEM 320

  Fly   353 ------LYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSG 411
                  :..:|.||:.||:|..|..|:.|.|.....|:...|.|:::.|.:.|||.:|..:| ..
plant   321 VKEGQGVVLEWSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQPIDARLLV-DV 384

  Fly   412 FGLTLSL--------LTLEE 423
            ||:.:.:        |.:||
plant   385 FGIGVRMRNDSVDGELKVEE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 97/475 (20%)
UDPGT 37..526 CDD:278624 90/456 (20%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 97/475 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.