DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT73B5

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:495 Identity:105/495 - (21%)
Similarity:184/495 - (37%) Gaps:116/495 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SQGANILGLFPSLSPSHLIIQMSAAKVLAENGHNVTVVTV-------LKPVVNHKN--------I 71
            |:..:|| .||.::..|:|..:..||:.:..|...|::|.       .||:...||        |
plant     6 SERIHIL-FFPFMAQGHMIPILDMAKLFSRRGAKSTLLTTPINAKIFEKPIEAFKNQNPDLEIGI 69

  Fly    72 TVIQVP---LSKEEAQQMSDTIGAMSKNDNSNMALSLL----RMSDQMDFMIRKNAETLMNDRVR 129
            .:...|   |...|..:.:|.|.:..|:|:.::.|..|    .|..|::..|.....:.:   |.
plant    70 KIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESFIETTKPSAL---VA 131

  Fly   130 DLYL----NRGNKFD---LVISGYFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSY 187
            |::.    ....|..   ||..|.........:..:::.|...:||.....::..|.|:      
plant   132 DMFFPWATESAEKLGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSSTPFVIPGLPGD------ 190

  Fly   188 AGISNPAEGSKAVTFQRRLSSYMQSL------GFGVFSHLSERRNRNWYKEVYGNDPKMPEYSEM 246
              |....:.:.....:..:..:|:.:      .|||..:       ::|:               
plant   191 --IVITEDQANVAKEETPMGKFMKEVRESETNSFGVLVN-------SFYE--------------- 231

  Fly   247 LKNTSLVFFSSHAASEG-PIRPNVPSAIEIGGIQIKDKPDPL-PQNIAEFLGNATDGAIL-LSLG 308
            |::....|:.|..|... .|.|...|..|:|....:.|...: .|...::|.:.|.|::: ||.|
plant   232 LESAYADFYRSFVAKRAWHIGPLSLSNRELGEKARRGKKANIDEQECLKWLDSKTPGSVVYLSFG 296

  Fly   309 SNVQGKHLNPDTVAKMFNVLSKLKERVIW---KWEDQ------------ENTPGKSANILYSKWL 358
            |   |.:...|.:.::...|....:..||   |.|:|            |.|.||  .::...|.
plant   297 S---GTNFTNDQLLEIAFGLEGSGQSFIWVVRKNENQGDNEEWLPEGFKERTTGK--GLIIPGWA 356

  Fly   359 PQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRN---------------ANAMV 408
            ||..||.|..|..|:.|.|.....|....|.||::.|:.|:|..|               |..:|
plant   357 PQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGATELV 421

  Fly   409 KSGFGLTLSLLTLEEKPFQE------AILEILSNPQYAER 442
            |.|..::.:.:   ||..:|      |:.|::...:..||
plant   422 KKGKLISRAQV---EKAVREVIGGEKAVREVIGGEKAEER 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 105/495 (21%)
UDPGT 37..526 CDD:278624 100/480 (21%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 105/495 (21%)
MGT 14..456 CDD:273616 100/482 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.