DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and ugt2b6

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001170806.2 Gene:ugt2b6 / 792506 ZFINID:ZDB-GENE-100402-4 Length:527 Species:Danio rerio


Alignment Length:557 Identity:140/557 - (25%)
Similarity:264/557 - (47%) Gaps:79/557 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAIGAVMGSSQGANILGLFPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHKNIT----- 72
            :::.:::.:.:..|:|..|  ...||.|......:.|.:.||:|||:.....:....|.:     
Zfish     8 LSLLSLLSAGECGNVLVWF--TEGSHWINMKIVLETLIDRGHDVTVLVPDASLFMKANASDRFSY 70

  Fly    73 -VIQVPLSKEEAQQMSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYLN-- 134
             ...|.:.::|.:...:..          :..||..| ||::|...::.......:::|:.::  
Zfish    71 QPFNVSMDEQEMKVFIEEF----------LYFSLYEM-DQLNFFQMQSKVYEFTSKLQDMSISYC 124

  Fly   135 -------------RGNKFDLVISG--YFMNDFQLGFARKVNAPVIVLATMPPNHLLNPLIGN-PL 183
                         |.:|||:|.|.  |..:|.   .|.::|.|::........|....:.|. |.
Zfish   125 DGVLKSPGLLDKLRKHKFDVVFSDPIYQCSDI---VAEELNVPLVYTFRFSLAHAAERMCGQIPA 186

  Fly   184 EVSYAGISNPAEGSK---AVTFQRRLSSYMQSLGFGVFSHLSERRNRNWYKEVYGNDPKMPEYSE 245
            ..||.    |...||   .::|..|:.:.:..|....|:..:.::..|:|.|.:|   :...|.|
Zfish   187 PPSYV----PGAMSKLTDKMSFTERIYNMLFYLSQDAFAIFAWKKIDNYYTEYFG---RPTSYCE 244

  Fly   246 MLKNTSLVFFSSHAASEGPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFL-GNATDGAILLSLGS 309
            |:....:....::...|.| ||.||:...|||:.. ....|||:::.||: .:..||.::.:|||
Zfish   245 MMGRADIWLIRTYWDFEFP-RPFVPNFKYIGGLHC-TPAKPLPKDMEEFVQSSGEDGIVVFTLGS 307

  Fly   310 NVQGKHLNPDTVA-KMFNVLSKLKERVIWKW-EDQENTPGKSANILYSKWLPQDDILAHPNIKLF 372
            .| ||  .|..:: ::.:.|:::.::|:|:: .::.:|.|::..|.  ||:||:|:|.||..:.|
Zfish   308 LV-GK--VPKEISNRIASALAQIPQKVLWRYGGEKPDTLGENTRIY--KWIPQNDLLGHPKTRAF 367

  Fly   373 INHAGKGGITESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTL-SLLTLEEKPFQEAILEILSN 436
            |.|.|..|:.|:.|||.||:.:|:|.|||.|...|...|..:.: |:.:::.:...:.:..::::
Zfish   368 ITHGGTNGVYEAIYHGVPMVGIPLFGDQPDNMVHMTTRGAAVVVDSIKSMQPQELVDKLNTVIND 432

  Fly   437 PQYAERVKSFSTLYRDRPMTARESFLYWTEYVIRHHGAAHLQSPLVHMSFIAANNID----ICFL 497
            |.|.|.....|.::.||||...:..::|.|:|:|:.||.||:        :.|:|:.    .|..
Zfish   433 PSYKENAMRLSRIHHDRPMKPLDESVFWIEFVMRNKGAKHLR--------VEAHNLTWYQYHCLD 489

  Fly   498 IFVILVSVLVLIKF----LVQFIYRR--FISKPKKEK 528
            :|..|.:||.|:.:    :.:|...|  |.||.|.:|
Zfish   490 VFAFLTTVLTLVLYICFKMAKFFIMRCCFRSKRKSKK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 125/507 (25%)
UDPGT 37..526 CDD:278624 135/529 (26%)
ugt2b6NP_001170806.2 UDPGT 20..523 CDD:278624 138/540 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.