DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT2B10

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:519 Identity:133/519 - (25%)
Similarity:235/519 - (45%) Gaps:72/519 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KVLAENGHNVTVVTVLKPVV---NHKNITVIQV-PLSKEEAQQMSDTIGAMSKNDNSNMALSLL- 106
            |.|.:.||.|||:.....::   |..:...::| |.|             ::|.:..|:.:.|: 
Human    43 KELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTS-------------LTKTEFENIIMQLVK 94

  Fly   107 RMSD-QMD-----FMIRKNAETLMNDRVR----DLYLNR-------GNKFDLVISGYFMNDFQLG 154
            |:|: |.|     |...:.....:||.:|    |:..|:       .::||:|.:..::...:| 
Human    95 RLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGEL- 158

  Fly   155 FARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNP--------AEGSKAVTFQRRLSSYMQ 211
            .|...|.|.:.      :|..:|  |...|....|...|        ::.|..:||..|:.:.:.
Human   159 LAELFNIPFVY------SHSFSP--GYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLY 215

  Fly   212 SLGFGV-FSHLSERRNRNWYKEVYGNDPKMPEYSE----MLKNTSLVFFSSHAASEGPIRPNVPS 271
            .|.|.. |...:.::...:|.||.|....:.|...    .|...|..|...|     |..|||..
Human   216 VLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPH-----PFLPNVDF 275

  Fly   272 AIEIGGIQIKDKPDPLPQNIAEFL-GNATDGAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKERV 335
               :||:..| ...|||:.:.||: .:..:|.::.||||.|  .::..:....:...|:|:.::|
Human   276 ---VGGLHCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNMTEERANVIATALAKIPQKV 334

  Fly   336 IWKWEDQENTP-GKSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFAD 399
            :|:::.  |.| ....|....||:||:|:|.||..:.||.|.|..||.|:.|||.||:.:|:|.|
Human   335 LWRFDG--NKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFD 397

  Fly   400 QPRNANAMVKSGFGLTLSLLTLEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARESFLYW 464
            ||.|...|...|..:.:...|:.......|:..::::|.|.|.:...|.:..|:|:...:..::|
Human   398 QPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFW 462

  Fly   465 TEYVIRHHGAAHLQSPLVHMSFIAANNIDICFLIFVILVSVLVLIKFLVQFIYRRFISKPKKEK 528
            .|:|:||.||.||:....::::...:::|:...:...:.:||.:|.....|.:.:|..|.||.|
Human   463 IEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 123/479 (26%)
UDPGT 37..526 CDD:278624 130/515 (25%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 130/515 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.