DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and UGT2B7

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001065.2 Gene:UGT2B7 / 7364 HGNCID:12554 Length:529 Species:Homo sapiens


Alignment Length:536 Identity:136/536 - (25%)
Similarity:253/536 - (47%) Gaps:64/536 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LIIQMS-------AAKVL---AENGHNVTVVTVLKPVVNH-KNITVIQVPLS------KEEAQQM 86
            |:||:|       ..|||   ||..|.:.:.|:|..::.. ..:||:....|      ...|.::
Human    10 LLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKI 74

  Fly    87 SDTIGAMSKNDNSNMAL-SLLRMSDQMDFMIRKNAETLMNDRVRDLYLNRGN---KF--DLVISG 145
            .....:::|.:..|..: .:.|.||     :.|:...|...:|:::....|:   ||  |:|.:.
Human    75 EIYPTSLTKTELENFIMQQIKRWSD-----LPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNK 134

  Fly   146 YFM-----NDFQLGFARKV-----------NAPVIVLATMPPNHLLNPLIGNPL-EVSYAGISNP 193
            .||     :.|.:.||..:           |.|.:...:..|.:......|..: ..||..:. .
Human   135 KFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVV-M 198

  Fly   194 AEGSKAVTFQRRLSSYMQSLGFGVFSHLSERRNRNW---YKEVYGNDPKMPEYSEMLK-NTSLVF 254
            :|.:..:||..|:.:.:..|.|..:..:.:.  :.|   |.||.|....:.|  .|.| :..|:.
Human   199 SELTDQMTFMERVKNMIYVLYFDFWFEIFDM--KKWDQFYSEVLGRPTTLSE--TMGKADVWLIR 259

  Fly   255 FSSHAASEGPIRPNVPSAIEIGGIQIKDKPDPLPQNIAEFL-GNATDGAILLSLGSNVQGKHLNP 318
            .|.:.....|:.|||..   :||:..| ...|||:.:.:|: .:..:|.::.||||.|  .::..
Human   260 NSWNFQFPYPLLPNVDF---VGGLHCK-PAKPLPKEMEDFVQSSGENGVVVFSLGSMV--SNMTE 318

  Fly   319 DTVAKMFNVLSKLKERVIWKWE-DQENTPGKSANILYSKWLPQDDILAHPNIKLFINHAGKGGIT 382
            :....:.:.|:::.::|:|::: ::.:|.|.:.. || ||:||:|:|.||..:.||.|.|..||.
Human   319 ERANVIASALAQIPQKVLWRFDGNKPDTLGLNTR-LY-KWIPQNDLLGHPKTRAFITHGGANGIY 381

  Fly   383 ESQYHGKPMLSLPVFADQPRNANAMVKSGFGLTLSLLTLEEKPFQEAILEILSNPQYAERVKSFS 447
            |:.|||.||:.:|:|||||.|...|...|..:.:...|:.......|:..::::|.|.|.|...|
Human   382 EAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLS 446

  Fly   448 TLYRDRPMTARESFLYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDICFLIFVILVSVLVLIKFL 512
            .:..|:|:...:..::|.|:|:||.||.||:.....:::...:::|:...:.|.:.:|:.::...
Human   447 RIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKC 511

  Fly   513 VQFIYRRFISKPKKEK 528
            ..|.:.:|..|.||.|
Human   512 CLFCFWKFARKAKKGK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 127/496 (26%)
UDPGT 37..526 CDD:278624 133/532 (25%)
UGT2B7NP_001065.2 UDPGT 24..525 CDD:278624 129/518 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.