DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and T19H12.12

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:98 Identity:25/98 - (25%)
Similarity:43/98 - (43%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRVEKFLLLAIAIGAVMGSSQGANILGLFPSLSPSHLIIQMSAAKVLAENGHNVTV-------VT 60
            :|:..|:.|:|    :......:.||...|....||:......|.::|::||:||:       :.
 Worm     1 MRLGTFIFLSI----LFFKCHSSKILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQPYHIALK 61

  Fly    61 VLKPVVNHKNITVIQV------PLSKEEAQQMS 87
            .|..:|.:|||.::..      .|.|.|.|..|
 Worm    62 NLDGLVKNKNIEILNYHPTHYEELLKAEPQAFS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 25/98 (26%)
UDPGT 37..526 CDD:278624 18/64 (28%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.