DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and Ugt36F1

DIOPT Version :10

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster


Alignment Length:69 Identity:13/69 - (18%)
Similarity:25/69 - (36%) Gaps:24/69 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SVNCAHLTAFRNLCSKQANIFLTHWINGGFYALESAFVMIHRNRVDEILKGIMH--KDTCADDLD 82
            |:.|       .||...|::.::              :...|.|..|:.:.:..  |.|..:| :
  Fly    12 SLQC-------RLCLHTADLLIS--------------IFGKRGREAEMCRKLREHLKLTVTED-E 54

  Fly    83 NLPR 86
            .||:
  Fly    55 TLPK 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 GT1_Gtf-like 25..464 CDD:340817 11/64 (17%)
Ugt36F1NP_609909.1 GT1_Gtf-like 21..448 CDD:340817 9/53 (17%)

Return to query results.
Submit another query.