DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and Ugt307A1

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_609097.2 Gene:Ugt307A1 / 33993 FlyBaseID:FBgn0031887 Length:502 Species:Drosophila melanogaster


Alignment Length:502 Identity:150/502 - (29%)
Similarity:257/502 - (51%) Gaps:54/502 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NILGLFPSLSPSHLIIQMSAAKVLAENGHNVTVVTVLKPVVNHK---NITVIQVPLS--KEEAQQ 85
            :|||||.::..|.|::.::..:.|.:.||::|:||.| |:...:   |::.|.:|..  |||.  
  Fly    32 HILGLFVNVHRSQLMVHLAVCRALLQRGHHLTLVTTL-PLEEQEIQGNVSHIYIPWQQPKEEV-- 93

  Fly    86 MSDTIGAMSKNDNSNMALSLLRMSDQMDFMIRKNAETLMNDRVRDLYL-NRGN-KFDLVISGYFM 148
                       .:|::.|.|.||     |...:::..|::.....::| |:.| .:||::.||..
  Fly    94 -----------SSSDLILRLERM-----FRRLEHSGDLLDLPEWKMFLRNQPNTPYDLLLLGYHF 142

  Fly   149 NDFQLGFARKVNAPVIVLATMPPNHLLNPLIGNPLEVSYAGISNPAEGSKAVTFQRR--LSSYMQ 211
            ||..||.|...|.||.:::|..|...:|.|:|||.|..|  :..|.:|      |:|  :|::: 
  Fly   143 NDHLLGVAAHFNCPVAIVSTQQPTGFVNSLMGNPEERWY--VPQPYDG------QQRSGISAWV- 198

  Fly   212 SLGFGVFSHLSERRNRNWYKEVYG---NDPKMPEYSEMLKNTSLVFFSSHAASEGPIRPNVPSAI 273
               ||::....|...|.....:|.   .:|:.|.:..|.::..|...:.|..|||||.|.:||.:
  Fly   199 ---FGMWEKFMEILARRVLARIYRLHFPEPQYPSFETMRRSVVLALSNHHMISEGPIAPLIPSMV 260

  Fly   274 EIGGIQIKDKPDPLPQNIAEFLGNATDGAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKERVIWK 338
            :||||.::.:.|..|..|:  .||.:  .|:.|||:....:....:.|.......::..:..|:.
  Fly   261 DIGGIVLEQQLDKTPLEIS--AGNRS--LIIFSLGTRFTWRKSTKELVRTFTKAFAQFPDYDIYW 321

  Fly   339 WEDQENTPGKSANILY-----SKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFA 398
            ..|..|  |.:.::.|     :||.||..:.....::|||.|.|||.::|:.::|.|||.||:..
  Fly   322 TYDGPN--GSAISLDYPHLKVAKWWPQTQMWQSGKVRLFITHGGKGSVSEALFYGVPMLGLPLIG 384

  Fly   399 DQPRNANAMVKSGFGLTLSLLTLEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARESFLY 463
            ||..|...|....:|||||...|......:||..:||:..|.|.:...|.||||||::..:...|
  Fly   385 DQRDNLQRMQSKNWGLTLSTNNLTHWKLAKAITRMLSDSSYGETILKASQLYRDRPVSPSDLVTY 449

  Fly   464 WTEYVIRHHGAAHLQSPLVHMSFIAANNIDICFLIFVILVSVLVLIK 510
            |.||::||.||.:|.:|...::.|..::||:.|:::.:|:..:.:::
  Fly   450 WIEYIVRHKGAKNLHNPARQLNIIEYHSIDVYFIVYGLLILTIAILR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 146/480 (30%)
UDPGT 37..526 CDD:278624 145/491 (30%)
Ugt307A1NP_609097.2 egt 13..492 CDD:223071 150/496 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445680
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D53444at6656
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
76.950

Return to query results.
Submit another query.