DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A3 and ugt-63

DIOPT Version :9

Sequence 1:NP_650229.2 Gene:Ugt37A3 / 41574 FlyBaseID:FBgn0038083 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_504369.1 Gene:ugt-63 / 182223 WormBaseID:WBGene00015449 Length:506 Species:Caenorhabditis elegans


Alignment Length:237 Identity:57/237 - (24%)
Similarity:109/237 - (45%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 GIQIKDKPDPLPQNIAEFLGN-ATDGAILLSLGSNVQGKHLNPDTVAKMFNVLSKLKE-RVIWKW 339
            |...|:...||......|:.: .:.|.||::.|:.:..:....:.......|:::|.| |:||..
 Worm   272 GAYCKESSKPLDLEFKTFIEHPKSKGTILIAFGTFIDWRKAPKNYYDAFATVVNRLSEYRIIWSM 336

  Fly   340 EDQENTPGKSANILYSKWLPQDDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFADQPRNA 404
            :. |..||...::..|.|:||:.||.|....||::|.|.....|......|.:.:|:|.:|.|||
 Worm   337 KG-ERPPGLKKHVKTSSWVPQNQILHHNKTVLFLSHGGLKSTKEVICSATPTIFVPMFGEQTRNA 400

  Fly   405 NAMVKSGFGLTLSLLTLEEKPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARESFLYWTEYVI 469
            ..:.:.||...::...:........:.|:|.:|.|.:....|.|.|.|:|:...:...:....::
 Worm   401 WLIKEKGFARIMNKFKINVDELDTHMREVLEHPNYQQNANKFLTYYMDQPIPTLDEGAFKFNRLV 465

  Fly   470 RHHG--AAHLQSPLVHMSFIAANNIDICFLIFVILVSVLVLI 509
            ::.|  .:|.....:.:|:....|:|   |:.|:.:.:|.|:
 Worm   466 KYGGKMPSHFYPKSLDLSYFTVLNVD---LLIVVPIMMLYLV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A3NP_650229.2 egt 1..490 CDD:223071 51/216 (24%)
UDPGT 37..526 CDD:278624 57/237 (24%)
ugt-63NP_504369.1 Glycosyltransferase_GTB_type <276..500 CDD:299143 54/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.