DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT85A3

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_173655.2 Gene:UGT85A3 / 838845 AraportID:AT1G22380 Length:488 Species:Arabidopsis thaliana


Alignment Length:440 Identity:80/440 - (18%)
Similarity:144/440 - (32%) Gaps:128/440 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HLIIQMSTAKVLAERGHNVTVITVLKPVVNHKNI-------TVIMVPLTKEES---------QQM 85
            |:...|..||:|..:|.:||.:..   |.||..:       .:..:|..:.||         ...
plant    24 HINPMMKVAKLLHVKGFHVTFVNT---VYNHNRLLRSRGANALDGLPSFQFESIPDGLPETGVDA 85

  Fly    86 SDTIGAMSKTDNSNMILSMLRMM------------------GQMEFMFDKMAGALKDDRVRDLYL 132
            :..|.|:|::...|.::...:::                  |.|.|..|.         ..:|.:
plant    86 TQDIPALSESTTKNCLVPFKKLLQRIVTREDVPPVSCIVSDGSMSFTLDV---------AEELGV 141

  Fly   133 NRDNKFDLVLSGYFMNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKG 197
            ...:.:.....|:...::...|.:|...||...:.:....|       ...|.::||: ::|:..
plant   142 PEIHFWTTSACGFMAYLHFYLFIEKGLCPVKDASCLTKEYL-------DTVIDWIPSM-NNVKLK 198

  Fly   198 KGMSFRQRLAGYSSSFFFGIFDFVTQRRSKRLYKELFGDDPNMPEYSELVKNTSLIFFASHAPSE 262
            ...||.:..........|.:.:....:|:..:....|.|..:     :::::...|.     |..
plant   199 DIPSFIRTTNPNDIMLNFVVREACRTKRASAIILNTFDDLEH-----DIIQSMQSIL-----PPV 253

  Fly   263 GPIRP--------------------------------------NVPAAIEIGGIQVKDTPDPLPQ 289
            .||.|                                      |....:..|.|.:..|     .
plant   254 YPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECLGWLNTKSRNSVVYVNFGSITIMTT-----A 313

  Fly   290 NMAEFL-GNATDGAILLSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWEDLEKTPGKSDNIF 353
            .:.||. |.|..|...|.:        :.||:|.....|:.|         |.|.:|   :|...
plant   314 QLLEFAWGLAATGKEFLWV--------MRPDSVAGEEAVIPK---------EFLAET---ADRRM 358

  Fly   354 YSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGN 403
            .:.|.||:.:|:||.:..|:.|.|.....|:...|.||:..|.|.:|..|
plant   359 LTSWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 80/440 (18%)
UGT85A3NP_173655.2 Glycosyltransferase_GTB_type 9..478 CDD:299143 80/440 (18%)
MGT 20..459 CDD:273616 80/440 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.